KEGG   Mus musculus (mouse): 79221Help
Entry
79221             CDS       T01002                                 

Gene name
Hdac9, AV022454, D030072B18Rik, HD7B, HD9, HDRP, Hdac7b, Mitr, mKIAA0744
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  histone deacetylase 9 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    79221 (Hdac9)
  09165 Substance dependence
   05034 Alcoholism
    79221 (Hdac9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    79221 (Hdac9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     79221 (Hdac9)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     79221 (Hdac9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 79221
NCBI-ProteinID: NP_077038
MGI: 1931221
Ensembl: ENSMUSG00000004698
Vega: OTTMUSG00000061412
UniProt: Q99N13 A0A0R4J1F3
Structure
PDB: 

Position
12; 12 A3
AA seq 588 aa AA seqDB search
MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVGRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDSKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNNGPAGNVTENEASALPPTPHP
EQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLNASNSLKDKQKCETQMLRQ
GVPLPSQYGSSIAASSSHVHVAMEGKPTSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQ
SPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQ
IHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQSMEDRAASKDNSARSDSSACVEDTLGQV
GAVKVKEEPVDSDEDAQIQEMECGEQAAFMQQVIGKDLAPGFVIKVII
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggacgtgaaatcagaggttcctatgggcctggagccc
atctcacctttagacctgaggacagatctcaggatgatgatgcctgtggtggatcctgtc
gtccgcgagaagcaactgcagcaagagttacttcttattcagcagcagcagcagatccag
aagcagctcctcatagcagagtttcagaagcagcacgagaatttgacaaggcagcatcaa
gcacaactccaggagcacatcaaggaacttctagccataaaacaacagcaagaactccta
gaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagaggcatcgcaga
gagcagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcagtggcaagc
acagaggttaagcagaagcttcaagaattcctgttgagtaaatcagcaacaaaagacact
ccaaccaatggaaagaatcattccgtgggccgccatcccaagctctggtacacggctgcc
caccacacatcactggatcaaagctctccacccctcagtggaacgtctccatcctacaag
tacacattaccaggagctcaagatagcaaggatgatttccccttgagaaaaactgcctca
gagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagaggagaagcagt
cccttactcaggcggaaggatggaaatcttgtcacttcattcaagaagcgagtgtttgag
gtggcagaatcctcggtcagtagcagctctccagggtcaggtcccagttcaccaaacaat
ggccctgctgggaatgtgaccgaaaatgaggcttcagctctgcctcccacgcctcacccc
gagcaactggttccacagcagcgcatactaattcatgaagattccatgaacctgctaagt
ctctatacctccccgtccctgcccaatatcactctgggacttccagcagtgccgtcccca
ctcaatgcttctaactcactcaaagacaaacagaagtgcgagacacagatgctcagacaa
ggtgttcctctgcccagtcagtatggcagtagcattgcagcgtcctccagccacgttcat
gtagcaatggaaggaaaacccaccagcagccaccaggctctcctgcagcacctactgctg
aaggaacaaatgcgacagcaaaagcttctcgtggctggtggagttccattacaccctcag
tctcctttggcaacaaaagaaagaatttcaccaggcattagaggtacccacaaattgccc
cgccaccgacccctgaatcgaacccagtctgcacctttgcctcagagcacgctggctcag
ctggtcattcagcagcagcaccagcagttcctggagaagcagaaacaataccagcagcag
atccacatgaacaaactgctatcgaaatctattgaacaactgaagcaaccaggcagccac
cttgaagaagcagaggaggagcttcagggggaccaatccatggaagacagagcagcctct
aaggacaacagtgctaggagtgacagcagtgcttgtgtggaggacacgctgggacaagtt
ggggctgtgaaggtcaaggaggaacccgtggacagcgatgaagatgctcagatacaggaa
atggaatgtggggagcaggctgcttttatgcaacaggtaataggcaaagatttagctcca
ggatttgtaattaaagtcattatttga

DBGET integrated database retrieval system