KEGG   Mus musculus (mouse): 79464
Entry
79464             CDS       T01002                                 

Gene name
Lias, 2900022L22Rik, 4933425M12Rik, 7a5ex, C77512, LS, lip-syn
Definition
(RefSeq) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00785  Lipoic acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    79464 (Lias)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     79464 (Lias)
SSDB
Motif
Pfam: LIAS_N Radical_SAM
Other DBs
NCBI-GeneID: 79464
NCBI-ProteinID: NP_077791
MGI: 1934604
Ensembl: ENSMUSG00000029199
Vega: OTTMUSG00000028341
UniProt: Q99M04
Position
5; 5 C3.1
AA seq 373 aa
MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDE
YKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGG
EYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVD
RDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETV
PELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGLGETDEQVYATLKALRAADV
DCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLK
NLVARRKTKASKV
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctctacgctgctgggatacagctcgcagcctggggtcccggatatttggaagatat
gcgttcacggttagagcattaagttctttgccagataagaaaaaggaatttttgcataat
ggaccagaccttcaagattttgtatctggtgatcttgcagacaagagtacatgggatgaa
tataaaggaaacttaaagcgccagaaaggagaaaggctaagactacctccatggctaaag
acaaagatacccatgggtaaaaactacaataaactgaaaaatacattgcggaatttaagt
ctccacacagtgtgtgaggaagcccggtgccccaacattggagagtgttggggaggtggg
gaatatgccacagccacagccacgatcatgttgatgggggacacatgcacaagaggttgc
agattttgttccgttaagaccgcaagaaatccccctccattggatgccaatgagcccgac
aatacggccaaagcaattgcagagtggggtctggattatgttgtcctgacgtcggtggat
cgagatgatgtggccgacgggggagctgagcacatcgccaagaccgtgtcatgcttgaag
gaaaggaatccaaaaatcctcgtggaatgcctcaccccagacttccgaggtgatctgaga
gcagtggagaaggtggctctgtctggattagatgtgtatgcacacaatgtggagactgtc
cccgagttacagaggaaagttcgtgatccccgggccaattttgaccagtctcttcgtgta
ctgagacatgccaaggaggtccagcctgatgttgtttccaaaacatcgataatgctgggc
cttggtgagacagacgagcaagtctatgccacactgaaagctctccgtgcggccgacgtg
gactgtttaactctagggcagtacatgcagccaacgaagcgccaccttaaggttgaagaa
tatgttactcctgagaagttcaaatactgggaaaaagtagggaatgaacttggatttctc
tatacggcaagtggtcctttggtgcgatcttcatataaagcaggtgaatttttcctgaaa
aatctagtggctagaagaaaaacaaaagcttctaaagtgtag

DBGET integrated database retrieval system