KEGG   Mus musculus (mouse): 79554Help
Entry
79554             CDS       T01002                                 

Gene name
Cptp, Gltpd1
Definition
(RefSeq) ceramide-1-phosphate transfer protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: GLTP DUF2833
Motif
Other DBs
NCBI-GeneID: 79554
NCBI-ProteinID: NP_077792
MGI: 1933107
Ensembl: ENSMUSG00000029073
Vega: OTTMUSG00000010888
UniProt: Q8BS40
Structure
PDB: 

Position
4 E2; 4 87.66 cM
AA seq 216 aa AA seqDB search
MDDSEKDFNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAK
LQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWL
QLFLDGLRTSSEDARTSTLCSEAYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNME
STEQAVEMLGEALPFIEHVYDISQKLYAEHSLLDLP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatgactcagagaaagatttcaaccttaaagtcgtcctggtcagcttcaagcagtgt
ctcactgacaagggagaggtgctgctggaccactatattgccggctggaagggacttgtc
aggtttctaaacagcctgggggccgtcttctcattcatttccaaggatgtggtcgcaaag
ctgcagatcatggagcgtctgagaagcagcccacagtctgaacactacgctagcttgcag
tccatggtagcctacgaggtgagcaacaagctggtggacatggatcaccgttcccatccc
cgacaccctcactcaggctgccggactgtgctgcgcctacatcgtgctctgcactggcta
cagctgttcctggacggcctgcgcaccagctctgaggatgctcgtacctccacactctgc
agtgaggcctacaatgccacgctggctaactatcactcctggatagtacgtcaagctgtc
actgtggccttctgtgccttaccctcacgcaaggtcttcctcgaggccatgaatatggag
tccactgagcaagcagtggagatgctgggggaggccctgcccttcattgagcatgtgtat
gacatctcccagaagctctatgctgagcattccctgctagacctgccctag

DBGET integrated database retrieval system