KEGG   Mus musculus (mouse): 80284
Entry
80284             CDS       T01002                                 

Gene name
Smim12, BC003266
Definition
(RefSeq) small integral membrane protein 12
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UPF0767
Other DBs
NCBI-GeneID: 80284
NCBI-ProteinID: NP_084528
MGI: 1933141
Ensembl: ENSMUSG00000042380
Vega: OTTMUSG00000009381
UniProt: Q78RX3
Position
4; 4 D2.2
AA seq 92 aa
MWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKTPQPVEEEKSILERREDRKLDE
MLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgtggcctgtgctttggaccgtggtgcgaacctatgccccctatgtcaccttccctgtg
gcctttgtggtcggggctgtgggctaccacctggaatggttcatcaggggaaagactcct
cagcctgtggaggaggagaagagcatcctggagcgccgagaggaccgaaagctggatgag
atgctaggcaaggaccacactcaggtggtgagccttaaggacaagctagaatttgcccct
aaagcagtcctgaacagaaaccgtccagagaagaactaa

DBGET integrated database retrieval system