KEGG   Mus musculus (mouse): 80285
Entry
80285             CDS       T01002                                 

Gene name
Parp9, ARTD9, AW214463, BC003281, Bagl, Bal, PARP-9
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    80285 (Parp9)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     80285 (Parp9)
SSDB
Motif
Pfam: Macro PARP ABC_tran_Xtn
Other DBs
NCBI-GeneID: 80285
NCBI-ProteinID: NP_084529
MGI: 1933117
Ensembl: ENSMUSG00000022906
Vega: OTTMUSG00000023901
UniProt: Q8CAS9
Position
16; 16 B3
AA seq 830 aa
MAYYMDTWAAAPAERPANNSLEEHYRWQIPIKHNVFEILKSNESQLCEVLQNKFGCISTL
SCPTLAGSSSPAQRVFRRTLIPGIELSVWKDDLTRHVVDAVVNAANENLLHGSGLAGSLV
KTGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCHLIIHAVGPRWTVTNSQTAIELLK
FAIRNILDYVTKYDLRIKTVAIPALSSGIFQFPLDLCTSIILETIRLYFQDKQMFGNLRE
IHLVSNEDPTVASFKSASESILGRDLSSWGGPETDPASTMTLRIGRGLTLQIVQGCIEMQ
TTDVIVNSGYMQDFKSGRVAQSILRQAGVEMEKELDKVNLSTDYQEVWVTKGFKLSCQYV
FHVAWHSQINKYQILKDAMKSCLEKCLKPDINSISFPALGTGLMDLKKSTAAQIMFEEVF
AFAKEHKEKTLTVKIVIFPVDVETYKIFYAEMTKRSNELNLSGNSGALALQWSSGEQRRG
GLEAGSPAINLMGVKVGEMCEAQEWIERLLVSLDHHIIENNHILYLGKKEHDVLSELQTS
TRVSISETVSPRTATLEIKGPQADLIDAVMRIECMLCDVQEEVAGKREKNLWSLSGQGTN
QQEKLDKMEESYTFQRYPASLTQELQDRKKQFEKCGLWVVQVEQIDNKVLLAAFQEKKKM
MEERTPKGSGSQRLFQQVPHQFCNTVCRVGFHRMYSTSYNPVYGAGIYFTKSLKNLADKV
KKTSSTDKLIYVFEAEVLTGSFCQGNSSNIIPPPLSPGALDVNDSVVDNVSSPETIVVFN
GMQAMPLYLWTCTQDRTFSQHPMWSQGYSSGPGMVSSLQSWEWVLNGSSV
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggcctattacatggatacatgggcggcagctcccgccgaaagaccagccaacaattct
cttgaagaacattatagatggcaaattcccattaaacacaatgtcttcgaaattttaaag
agcaatgagagtcagctatgtgaagtcctccaaaataagtttggatgcatctctaccctg
agctgtccaactctagcagggagcagctctcctgctcagagagtcttcagaaggaccctg
atccctgggatagagttatctgtctggaaggatgaccttaccagacacgttgttgatgct
gtggtgaacgcagccaatgaaaaccttttgcatggaagtggcctggccggaagcttggtg
aaaactggtggctttgaaatccaagaagagagcaaaagaatcattgccaacgttggtaaa
atctcagttggtggaatcgctatcaccggtgcggggagacttccttgccatttgattatc
catgcggttggacctcggtggacagttacgaacagccagacagctatcgaattactgaaa
tttgccattaggaacattctagattatgtcaccaaatatgatctacgcattaagacagta
gcaattccagccctgagctctggaattttccagttccctctggatttgtgtacaagcata
attttagaaactatccggctttatttccaagacaagcaaatgttcggtaatttgagagag
attcatctggtgagcaatgaggaccccactgttgcgtcctttaaatccgcctcagaaagc
atcctagggagggacctgagctcttgggggggtccagaaactgaccctgcttccaccatg
actcttcgcatcggccggggcctgactctccagattgtccaaggctgtattgaaatgcaa
acaacagatgtaattgttaattctggatacatgcaggattttaaatcaggacgagtggca
cagtcgattcttagacaagcaggggttgaaatggaaaaggaacttgacaaggttaacctg
tccacagattatcaagaggtgtgggtcacaaaaggatttaaattgtcctgtcagtatgtc
ttccatgtggcatggcattcccaaatcaacaaataccagatattgaaagatgcaatgaag
tcctgtctagaaaaatgccttaaaccagatataaattccatttcctttcctgctctcggg
acaggattgatggatttgaagaagagtacagcagctcagataatgtttgaggaagttttt
gcatttgctaaagagcacaaggaaaaaacgctaactgtaaagattgtgatctttccagta
gatgtggagacgtacaagattttttatgctgaaatgacaaaaaggtccaacgagctgaat
ctcagcggtaatagtggtgctttagccctgcagtggtccagtggggagcaaagaagaggc
ggccttgaagctggatctcctgccatcaatctcatgggtgtaaaagtgggagagatgtgt
gaggcccaggaatggattgaaaggttgctggtctccctggaccaccacatcattgagaat
aatcatattctctatcttgggaaaaaagagcacgacgtgctgtctgagctccagaccagc
acaagagtctccatttcagagactgtcagtccaagaacggccactttggagattaaaggt
ccccaggctgacctcattgacgcagttatgaggattgaatgtatgctgtgtgacgttcag
gaagaagtggcaggaaaaagggagaaaaatctttggagcttgtcaggacaggggaccaac
cagcaagaaaaactggataaaatggaagaatcgtacacatttcaacgatacccagcatca
ttaactcaggaacttcaggaccgaaagaaacagtttgaaaagtgtggcttgtgggttgtg
caggtggagcagatagacaataaggtgctgctggctgccttccaagagaagaagaaaatg
atggaagagaggacgccaaagggatctgggagccaaaggttgtttcagcaggtcccacat
cagttctgcaatacggtgtgcagagtcggcttccacagaatgtattcgacatcctataac
ccagtttatggagccggcatatatttcaccaagagcctcaaaaatctagcagacaaggtc
aagaaaacctcaagcacagacaagctaatctatgtgtttgaggcagaagtactcacaggg
tccttctgtcagggtaattcctcaaatatcatccctccaccattgagtcctggggcctta
gatgtcaatgacagcgtagttgacaatgtttccagccctgaaaccattgttgtttttaat
ggcatgcaggccatgcccctgtacttgtggacttgcacacaggataggacattctcacag
catccgatgtggtcacagggctactcatcaggaccaggaatggtctcttcgctgcagtcc
tgggaatgggtcttaaatggcagctctgtttag

DBGET integrated database retrieval system