KEGG   Mus musculus (house mouse): 80291
Entry
80291             CDS       T01002                                 
Symbol
Rilpl2
Name
(RefSeq) Rab interacting lysosomal protein-like 2
  KO
K25403  RILP-like protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    80291 (Rilpl2)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   80291 (Rilpl2)
SSDB
Motif
Pfam: RILP Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 80291
NCBI-ProteinID: NP_084535
MGI: 1933112
Ensembl: ENSMUSG00000029401
UniProt: Q99LE1
Structure
Position
5:complement(124601328..124616298)
AA seq 197 aa
MEDHPVREEEDGEEDEGALAKSPLQLTTDDVYDISYVVGRELMALGSDPRVTRLQFKIVR
VMEMLETLVNEGSLAVEELRMERDNLKQEVEGLRKAGVSGAQVNLGPDKMVVDLTDPNRP
RFTLQELREVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAVVAMGNGEKE
ERTIMKKLFSFRSGKHT
NT seq 594 nt   +upstreamnt  +downstreamnt
atggaggatcaccccgtgcgggaggaggaggacggcgaggaagacgagggcgccctggcc
aagagccccctgcagctgaccaccgacgacgtgtacgacatctcctatgtagtgggccgc
gagctgatggccctgggcagcgacccccgcgtcacccggctgcagttcaagatagtacgt
gtgatggagatgctggagacgctggtaaacgagggcagcctggcggtcgaggaactgagg
atggagagagacaacctcaagcaagaggtggaggggctgcggaaagccggtgtgtccgga
gcccaggtaaacttgggaccggacaagatggtagtggatctgacagaccccaaccgtccc
cgcttcactctgcaagagctgagggaggtgctgcaggagcgaaacaagctcaagtcgcag
ctgctgctggtgcaggaggaactgcagtgctacaggagtggtctacttccacccagagaa
actccaggaggaagaagagagaaggatgctgtggttgccatgggcaacggcgagaaggag
gagaggaccattatgaagaagctgttctctttccggtcagggaagcatacctag

DBGET integrated database retrieval system