KEGG   Mus musculus (mouse): 80297Help
Entry
80297             CDS       T01002                                 

Gene name
Sptbn4, 1700022P15Rik, 5830426A08Rik, ROSA62, SpbIV, Spnb4, dyn, lnd, nmf261, nmf379, qv
Definition
(RefSeq) spectrin beta, non-erythrocytic 4
  KO
K06115  spectrin beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    80297 (Sptbn4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     80297 (Sptbn4)
  Intermediate filaments
   Intermediate filament-binding proteins
    80297 (Sptbn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin PH_9 PH PH_11
Motif
Other DBs
NCBI-GeneID: 80297
NCBI-ProteinID: NP_001186163
MGI: 1890574
Ensembl: ENSMUSG00000011751
Vega: OTTMUSG00000023763
UniProt: E9PZC2
Position
7 A3; 7 15.88 cM
AA seq 1241 aa AA seqDB search
MLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKK
LGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLHMESQLQDVDPGGDLAT
VNSQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVGERQSAVGERLVRLLEPL
QERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGTGLQAVQQHIKKNQGLRREI
QAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTGLREAAERRQQTLDAAFQVE
QYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQC
RALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHWIA
EKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAAT
MAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTAPP
EPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGW
KELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYH
QGLKTELEARVPELATCQELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWL
QQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERF
SSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRA
SDTLSAEVRTRVGYVRQELKPERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAAT
ELVRPRSERQELADRAEELPRRRRSERQESVDQPEETARRRRPERQESADHEGPHSLTLG
RYEQMERRRERRERRIERQESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGIPAGVP
SLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPA
QGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGP
ASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVA
NSVAEHAEIARWGQTLPTTSSTDEGNPKREGGERRASGRRK
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgctgatggctcgtgatggcacccgggaagacagccacaagctgcacaagagatggctc
cggcaccaggcgttcatggctgagctggctcagaataaggagtggctggagaagatagaa
agggagggccagcaactgatgcaggagaaaccggagctggcagcctctgtgcgcaagaaa
ttaggtgagatccggcagtgctgggcggagctggagagcaccacacaggccaaggcgcgc
cagctcttcgaggccagcaaggcggaccagctagtgcagagcttcgcggagctggacaag
cggctgcttcacatggaaagccagctgcaagacgtagaccccggtggggacctggccact
gtcaacagccagctcaagaagttacagtccatggagtctcaggtggaggagtggtgccga
gaggtgggcgagcttcaggcgcagacggcggcgcttccgctggagcaggcgagcaaggag
ttggtgggggagcggcagagtgcggtgggcgagcgcctggtgcgcctgctggagcctttg
caggagcgacgccgcttgttgctggcatccaaggagctgcatcaggtggcccacgacctg
gacgatgaactggcttgggttcaagagcggctgccactggccatgcagacagagcgaggc
actggcttgcaggctgtccagcagcacatcaaaaagaaccagggcctgcggcgggagatc
caggctcacgggccgcgcttggaggaggtgctggagcgcgcgggcgtgctggcctcgctg
cgcagcccagaggccgaagcggtgcgccgtggccaagagcagctgcagagcgcctggacc
gggctgcgggaagcggccgaacggcggcagcagacgctggacgccgccttccaggtggaa
cagtactactttgacgtggctgaggtggaggcatggctgggcgagcaggagctgctcatg
atgagtgaggacaagggcaaggatgaacagagcaccctgcagctgctcaagaagcattta
caactggaacagggcgtggagaactatgaggaaagcatcgcccagctgtcacgccagtgc
cgggcgctactggaaatgggacacccagacagtgagcaaatcagccgccgacagtcccaa
gtggatcgcctctatgtggcgctcaaggagctgggcgaggaacgcagggtgagcctggaa
cagcagtactggctctaccagctcagccgccaggtggatgagctggaacactggatagcc
gagaaggaggtggtagctggctccccagagctgggccaggacttcgaacacgtgtcggtg
ctacaggagaaattctcagagtttgccagtgagacaggaaccgcagggcgggagcggctg
gcggcggtcaaccagatggtggacgagctgattgagtgtggtcacacagcagcggccacc
atggctgagtggaaggacgggctgaacgaggcctgggctgagctgctggaactcatgggc
actcgggcccagctgctcgctgcctctcgggagctgcataagttcttcagcgatgcccgg
gagcttcaagggcagattgaggagaagcggaggaggctgccccgcctgacggcaccacct
gaacccagacccagtgccagctccatgcagcggaccctgcgagcctttgagcacgacctg
cagctcctcgtgtcccaggtacggcagctgcaggaaggggcggcccagctgcggacggtg
tacgctggcgagcacgccgaggccatcgccagccgcgagcaggaggtgttgcagggctgg
aaggagctgctagcagcctgtgaagatgctcgtctgcacgtcagctccacggccgacgcc
ctgcgcttccacagccaggcccgcgacctgctctcctggatggacggcatcgcgggccag
atcggggcagctgacaaacccagggatgtgtcatcggtggaggtgcttatgaactaccac
cagggcctgaagacagagttggaggcgcgcgtgcctgagctggcaacctgccaggagctg
gggcggtctctattactcaacaaaagcgccatggctgatgagatccaggcccagctggac
aagctgggaagccggaaggaggaggtgtcggagaagtgggaccgtcactgggagtggctg
cagcagatgctggaggtacaccagtttgctcaggaggccgtggtggctgacgcctggctg
acagctcaggaaccgctcctgcagagccgggagctgggcagcagtgtggatgaggtggag
cagcttatccggcgacacgaggccttccgaaaagcagctgcggcctgggaggagaggttc
agctctctgcggcgcttgaccacgatcgagaaactcaaggcagaacagagtaagcagcca
cccacccccttactggggcgcaagttctttggggaccccacagagctggcggccaaggca
gcgcctttgctgcgtccagggggctatgacaggggcctggagcctttggcccgcagggcc
tcggacacgctgtcagcggaggtgcggacccgggttgggtatgtgcgccaggagctcaag
cccgagcgtctccagccgcgcattgaccggctgccagagacctcggggaaggtagaaccc
gcggccccgacagccgcagcgttggacacgacggacacccctgggactccggcggcgacg
gagttggtccggccccggtcggagcgccaggagttagcggatcgtgcggaggagctgcca
cggagacgaagatcagaacgccaggagtccgtggatcaaccagaggagacagcgcggagg
cggcggcctgagcgccaggagtccgcggaccacgaggggccgcacagccttactctaggt
cgctacgagcagatggagagacggcgggagcggagggagcggcggatagaacgacaggag
tctagcgaacaggagactcccaccaggggagagctggtcaaagggaaggccactctggct
gatattgtggagcaacttcaggagaaagaggcaggcccagggatccctgctggggtgccg
tcgctgcctcagcctcgcgagcttccccctggtcgcctgcccaacgggcttgagccgccc
gagcggacacctcggcccgatcggccgcgggcacgggaccggcccaagccgcgccggcgg
ccacggcctcgagagggtggtgagggcgggggaagccggcgctcgcgctccgcccctgcc
cagggaggctccgcccccgcgccgccacctccgcccactcacacagtgcagcacgagggc
ttcctgctgcgcaagcgcgagctcgacgctaaccgcaagtcgtccaaccggtcatgggtg
agcctgtactgtgtgctcagcaagggggagctgggcttctacaaggactccaaaggccca
gcatcagggggcacgcatggtggggaaccactgctcagcctgcacaaagccaccagcgag
gtggctagtgactacaagaaaaagaagcatgtcttcaagctccagacccaggatggcagt
gagttcttgctccaggctaaagatgaggaggagatgaacggctggctggaggctgtggct
aactccgtggcagaacacgccgagatcgcccgatggggtcagacactacctaccacatca
tccacagatgagggcaaccccaagcgtgagggcggggagcgtagggccagcgggcgccgg
aagtga

DBGET integrated database retrieval system