KEGG   Mus musculus (house mouse): 80718
Entry
80718             CDS       T01002                                 
Symbol
Rab27b, 2310021G14Rik, B130064M09Rik
Name
(RefSeq) RAB27B, member RAS oncogene family
  KO
K07886  Ras-related protein Rab-27B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    80718 (Rab27b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    80718 (Rab27b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    80718 (Rab27b)
   04031 GTP-binding proteins [BR:mmu04031]
    80718 (Rab27b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    80718 (Rab27b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   80718 (Rab27b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    80718 (Rab27b)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 AAA_24 GTP_EFTU ATP_bind_1 TPP_enzyme_M AAA_22 Gtr1_RagA AAA_7 Septin
Other DBs
NCBI-GeneID: 80718
NCBI-ProteinID: NP_001076022
MGI: 1931295
Ensembl: ENSMUSG00000024511
UniProt: Q99P58 Q549X4
Structure
Position
18:complement(70112202..70274704)
AA seq 218 aa
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADG
ASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDL
IMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC
NT seq 657 nt   +upstreamnt  +downstreamnt
atgactgatggagactatgattatctgattaaactcctggcccttggagactcaggagtc
gggaagacaacatttctctatagatacacagacaataaattcaatcccaaattcatcacc
acagtgggaatagattttcgggaaaaacgtgtggtttatgacacacaaggagcagatgga
gcgtcaggaaaagcgtttaaggtacatctgcagctttgggacactgctggacaagagcgg
ttccggagccttaccactgccttcttcagagatgccatgggcttcttactgatgtttgac
ctcaccagtcaacagagcttcttgaatgtcagaaactggatgagtcaactgcaggcaaat
gcttactgtgaaaacccagacatagtattaattggcaacaaggcagacctgccagaccaa
agggaagtcaatgaacggcaagcacgggagctggctgaaaaatatggcataccatacttc
gaaacaagcgcagctacaggacagaatgtagagaagtcagtggaaacgcttctggactta
atcatgaagagaatggaaaagtgtgtagagaagacacaggttccggacactgtcaatgga
ggaaattctggaaagctggatggggaaaagccagcagaaaagaaatgtgcctgctag

DBGET integrated database retrieval system