KEGG   Mus musculus (mouse): 80733Help
Entry
80733             CDS       T01002                                 

Gene name
Car15, AI315043, Ca15, Cals2
Definition
(RefSeq) carbonic anhydrase 15
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    80733 (Car15)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     80733 (Car15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 80733
NCBI-ProteinID: NP_085035
MGI: 1931324
Ensembl: ENSMUSG00000090236
Vega: OTTMUSG00000028899
UniProt: Q99N23
Position
16 A3; 16 11.05 cM
AA seq 324 aa AA seqDB search
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccctggacttcttgctcagcttcctccttatacaactggcggcacaggtggac
tccagtggtacctggtgctacgactcccaagacccaaagtgtggccctgcccactggaag
gaactagcacctgcctgtgggggcccaacccagtcccctatcaacattgaccttcgattg
gtccagcgggactacactcttaagcccttcatctttcaaggctatgattcagcccctcaa
gatccttgggtcctggagaacgatggccacacagtgctacttcgagtaaattcctgtcag
cagaactgcccagccatccgaggggctgggctcccgtcaccagagtaccggctactgcag
ctgcacttccactggggcagcccagggcaccaaggctccgagcacagcctggatgagaag
catggctctatggagatgcacatggtccacatgaacacaaagtaccagagcatggaggat
gcacggagccaaccagatgggtttgctatactggctgtgctgttggtggaggaagacagg
gacaataccaatttctctgccattgtgtctggcctgaaaaatttatcttcacctggggta
gctgtgaatctgacgtccacctttgcactggcctctctgctgccaagtgctttgcggctc
ttgcggtactaccgatactctgggtctctgaccacgccgggctgtgagccagcggtgctc
tggactgtctttgaaaacaccgtacccattgggcatgcgcaggtagtccagttccaggcc
gtgcttcagactgggccaccaggtttgcaccccagaccactcacgagtaatttccgcccc
cagcagcctcttggagggcgcaggatatcagcctctcccgaagcatccgtccgatcatca
gtctctaccctgccctgtttgcacctggctcttgtgggcttgggagttggcctgagactc
tggcagggtccctag

DBGET integrated database retrieval system