KEGG   Mus musculus (mouse): 80743
Entry
80743             CDS       T01002                                 

Gene name
Vps16, 1810074M16Rik, mVPS16
Definition
(RefSeq) VSP16 CORVET/HOPS core subunit
  KO
K20180  vacuolar protein sorting-associated protein 16
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    80743 (Vps16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    80743 (Vps16)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    80743 (Vps16)
   Hops complex
    80743 (Vps16)
SSDB
Motif
Pfam: Vps16_C Vps16_N
Other DBs
NCBI-GeneID: 80743
NCBI-ProteinID: NP_001349580
MGI: 2136772
Ensembl: ENSMUSG00000027411
Vega: OTTMUSG00000015524
Position
2; 2 F1
AA seq 547 aa
MVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALL
LEAQKEYEKESQKADEYLREIQELGQLIQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCF
LDRFPPDSFVHMCQDLRVLNAIRDYHIGIPLTYTQYKQLTIQVLLDRLVLRRLYPLAIQI
CEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGC
GRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVLLHLKNELNRGDFFM
TLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ
TAADAFYKAKNEFAAKATEDQMRLLRIQRRLEDELGGRFLDLSLHDTVTTLILGGHNKRA
EQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEA
KKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLSHCTGATDGAIADKIQRA
RAQAQKK
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggtggtgggcaatgcgcctgaaagcatccagtttgtgctcgatgaggactcctactta
gtgcctgagcttgatggggtccgcatcttctcccgaagcacccatgagttcctgcatgaa
gtcccagtggccagtgaagagatcttcaaaattgcctcaatggcccctggagcactgctg
ttagaggcccagaaggaatatgagaaagagagccagaaagcagatgagtacctgcgggag
atccaggaactgggccagctgatccaggctgtgcagcagtgcattgaggctgcaggacat
gagcaccagccagacatgcaaaagagtctgctcagggcggcttcatttggaaagtgtttc
cttgacagatttccacctgacagcttcgtgcacatgtgtcaggaccttcgagtgctcaat
gctattagagactaccacattgggatccctctcacctacacccaatacaagcagctcacc
atccaggtgctgctagacaggcttgtgttgcggaggctttatcccctggctatccagata
tgcgagtacctgcgccttcctgaagtccagggtgtcagcaggatcctagcccactgggcc
tgctacaaggtgcagcagaaagatgtctcagatgaagatgtagcacgggctattaatcag
aagctgggtgacacgcctggtgtttcatactctgacattgctgcgagggcctatggctgt
ggccgcactgaactggccattaagctgctggagtatgagccacgctcaggggagcaggta
cctcttctcctaaagatgaagaggagcaaactggcactgagcaaggctattgagagtgga
gacactgacctggtgttgctgcacctaaagaatgaactcaaccgaggagactttttcatg
actctccggaaccaacccatggccctgagtttgtatcgacagttctgtaagcatcaggag
ctagacactctgaaggacctttacaatcaggacgacaatcaccaggagttgggcagcttc
cacatcagagccagctatgccgctgaagagcgtattgaagggcgagtggcagctctgcag
acggcagctgatgccttctacaaagccaagaatgaatttgcagccaaggccacagaggat
caaatgaggctcctgcggatacagcgacgcctagaggatgagctagggggcaggttccta
gacctatctctacacgacactgtcaccactcttatccttggaggccacaacaagcgggca
gagcagctggcacgtgactttcgcatccctgataagagactatggtggttaaagctggct
gccctggcagatttggaagattgggaggagctggagaagttttccaaaagcaagaaatca
ccgattggttacctgccctttgtagagatctgcatgaaacagcataacaaacatgaggcc
aagaagtatgcttcccgtgtgggccctgaacaaaaggtcaaggctttgcttcttgttggg
gatgtggctcaggctgcagaggtggctattgagcaccggaatgaaacagagctgagcctc
gttttgtcccactgcactggagccacagatggggccatagctgacaagattcagcgggcc
agggcacaagcccagaagaagtga

DBGET integrated database retrieval system