KEGG   Mus musculus (mouse): 80748
Entry
80748             CDS       T01002                                 

Gene name
2400006G15Rik
Definition
(RefSeq) cDNA sequence BC004004
Organism
mmu  Mus musculus (mouse)
SSDB
Other DBs
NCBI-GeneID: 80748
NCBI-ProteinID: NP_085038
MGI: 2136782
Ensembl: ENSMUSG00000052712
Vega: OTTMUSG00000028957
UniProt: Q99KU6
Position
17; 17 A3.3
AA seq 348 aa
MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRGPPQYPLLIA
VYKVLLTLGLILFTAYFVIQPFSSLAPEPVLSGANSWRSLVHHIRLVSLPITKKYMPENK
GVPLQGSQEDKPFPDFDPWSSYNCEQNESEPIPANCTGCAQILPLKVTLPEDTPKNFERL
RPLVIKTGQPLSSAEIQSFSCQYPEVTEGFTEGFFTKWWRCFPERWFPFPYPWRRPLNRS
QILRELFPVFTQLPFPKDSSLNKCFLIQPEPVVGSKMHKVHDLFTLGSGEAMLQLIPPFQ
CRTHCQSVAMPIESGDIGYADAAHWKVYIVARGVQPLVICDGTTLSDL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggatcttgctgctaatgagatcagcatctatgacaaactttcagagactgttgatttg
gtgagacagacaggccatcagtgtggaatgtccgagaaggcaatcgaaaaatttatcaga
cagctactggaaaagaatgaacctcaaaggggaccaccccagtaccctctccttatagcc
gtgtataaggtcctcctaactctgggattaatcttgttcactgcctactttgtaattcag
ccttttagctcattagcacccgagccagtgctttctggagcgaacagctggcgctcactc
gttcatcacattcggctggtgtccttgcccattaccaagaagtatatgccagagaataag
ggcgttcctctgcaagggagccaggaggacaaacccttcccagactttgacccctggtca
tcatataattgtgagcagaacgagtcagagcccatccctgccaactgcactggctgtgcc
cagatattacccctcaaggtaacgctgccagaagacactccaaagaattttgagagactc
cggcctctggtgatcaagacaggacagcctctgtcgtctgcagagattcagagcttctca
tgccagtaccctgaagtcacagagggcttcactgagggctttttcaccaagtggtggcgc
tgctttcctgagaggtggttcccatttccttacccatggagaagacctctaaacagatca
cagattttacgggaacttttccctgtttttacccaacttccatttccaaaagactcctcc
ttaaacaaatgtttcctgatccagccggaacctgtggtgggtagcaagatgcataaggtg
catgacctgttcaccctcggcagcggggaagccatgttgcagctcatccctcccttccag
tgccgaacacactgtcagtccgtggccatgccgatagagtctggagatattggctatgcc
gatgctgcccactggaaggtctacattgtagccagaggggtccagcctttggtcatctgc
gatggaaccactctctcggatctgtag

DBGET integrated database retrieval system