KEGG   Mus musculus (mouse): 80749
Entry
80749             CDS       T01002                                 

Gene name
Lrfn1, BC004018, SA, SALM2, Semo1
Definition
(RefSeq) leucine rich repeat and fibronectin type III domain containing 1
  KO
K16354  leucine-rich repeat and fibronectin type-III domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    80749 (Lrfn1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   80749 (Lrfn1)
SSDB
Motif
Pfam: LRR_8 LRR_4 Ig_3 I-set ig Ig_2 fn3 LRR_9 CbiM
Other DBs
NCBI-GeneID: 80749
NCBI-ProteinID: NP_001135393
MGI: 2136810
Ensembl: ENSMUSG00000030600
Vega: OTTMUSG00000045096
UniProt: Q2WF71
Structure
PDB: 
5XWU

Position
7; 7 A3
AA seq 766 aa
MAPGPFSSGLFSPPPAALPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVP
PAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHL
DSNRLAEVRGDQLRGLGNLRHLILGNNQIRKVESAAFDAFLSTVEDLDLSYNNLEALPWE
AVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGGGPK
PPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPL
ITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVTIT
TLRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSSDIATPGRPGAN
DSTSERRLVAAELTSSSVLIRWPAQRPVPGIRMYQVQYNSSADDSLVYRMIPSTSQTFLV
NDLAAGRAYDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAI
GGVIVASVLVFIVLLMIRYKVYGDGDSRRIKGTSRTPPRVSHVCSQTNGAGAQQASAPPA
PDRYEALREVAVPAAIEAKAMEAEATSTELEVVLGRSLGGSATSLCLLPSEETSGEESRA
MTGPRRSRSGALGPPTSAPPTLALVPGGAPARPRPQQRYSFDGDYGALFQSHSYPRRARR
TKRHRSTPHLDGAGGGAAGEDGDLGLGSARARLAFTSTEWMLESTV
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggctccaggccccttctcctccgggctcttttcgccaccacctgctgctcttcccttt
ctgctgttgctctgggcaggagcatctcgaggccagccctgccctggtcgctgcatctgt
cagaacgtggcacctacgctgaccatgctgtgtgcgaagacgggcctgctctttgtgcca
cccgccatcgacaggcgtgtggtagagctgcggctcactgacaacttcattgcggctgtg
cgtcgtcgagacttcgccaatatgaccagcctggtccacctcaccctgtctcgcaacacc
attggccaggtagcagccggcgcctttgctgacctccgggctctccgggccctgcacctt
gacagcaaccgcctggcagaggtgcgaggggatcagctccggggcttgggtaacctccgc
cacttgatcctcggcaacaatcagatccgtaaggtggagtcggcagcctttgacgccttc
ctgtccaccgtggaggacctggatctatcctacaacaacctggaggcactgccatgggag
gcggtgggtcagatggtgaacttgaacaccctcacgctggaccacaacctcattgatcac
attgcggagggcaccttcgtgcagctgcacaaactcgtgcgcttggacatgacctccaac
cgtctacataaattgccccccgacggactgttcctgaggtcccagggcggtgggcccaag
ccacccaccccattgacggtcagcttcggtggcaacccgctgcactgcaactgtgaactg
ctctggcttcggcgcctgaccagggaggacgacttggagacgtgtgccacgcccgagcat
ctcactgaccgctatttctggtccatcccggaggaggaatttctatgtgagcccccgctc
atcacacggcaagcagggggccgggccctggtggtagagggccaggctgtcagtctgcgc
tgccgggctgtgggtgaccccgagcccgtggtgcattgggtggcacctgatggacggctg
ctggggaactccagccggactcgggtccgtggtgacggaacgctggatgtgactatcacc
accctgagggacagcggtaccttcacttgcatagcctccaatgctgcgggggaagccaca
gcacctgtggaggtatgtgtggtacctctgccactgatggcgcccccacccgctgccccg
ccgcctctcactgaacctggttcttctgacatcgccacaccaggcagacctggtgccaac
gactcaaccagtgagcgcaggcttgtggctgctgaactcacgtctagctctgtgctcatc
cgctggccggcccagaggccagtgcctggcatccgtatgtaccaagtgcaatacaacagc
tctgcagatgactccctagtctacaggatgatcccttctaccagccagaccttcctagtg
aatgacctggcggctggccgcgcctatgatttgtgtgtgttggcagtctatgacgacggg
gccaccgctctgccggctaccagagtggtgggctgtgtgcaattcaccaccgcgggagat
cctgcaccatgccgcccgctgagggcccatttcttgggcggcaccatgatcatcgccatc
gggggcgtcatcgtagcctcggtcctcgttttcatcgttctgctcatgattcgctacaag
gtgtacggagatggggacagccgccgcatcaaggggacgtccaggacgccccctcgggtc
agccacgtgtgctctcagaccaacggcgcaggtgcgcagcaggcctccgccccaccagct
ccagaccgctacgaggcgctgcgggaggtggctgtccctgcggccatcgaggcaaaggcc
atggaggccgaggcgacttccactgagctagaggtggtgcttggacgctctctgggtggc
tccgccacctcgctgtgcttgctgccctccgaggaaacttctggggaggaatctagggcc
atgaccggccctcgaaggagccgttcgggggccttggggcctccaacttcagcgccccca
acgctagctctggttcctgggggagccccggcccgaccgaggccacaacaacgctattcc
ttcgacggggactacggggcgctgttccagagtcacagttacccgcgccgcgcccggcgg
acaaagcgccaccggtccacgccacacctggacggggccggagggggcgcggccggggag
gacggagacctggggctgggctccgcccgggcacgcctggccttcaccagcaccgaatgg
atgctggagagtaccgtgtga

DBGET integrated database retrieval system