KEGG   Mus musculus (mouse): 80837Help
Entry
80837             CDS       T01002                                 

Gene name
Rhoj, 1110005O19Rik, AW210585, Arhj, TC10L, TCL
Definition
(RefSeq) ras homolog family member J
  KO
K07864  Ras homolog gene family, member J
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    80837 (Rhoj)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    80837 (Rhoj)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    80837 (Rhoj)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    80837 (Rhoj)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    80837 (Rhoj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf TniB
Motif
Other DBs
NCBI-GeneID: 80837
NCBI-ProteinID: NP_075764
MGI: 1931551
Ensembl: ENSMUSG00000046768
Vega: OTTMUSG00000027646
UniProt: Q9ER71
Position
12; 12 C3
AA seq 214 aa AA seqDB search
MSCRERTDSSCGCNGHEENRILKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAV
TVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
DCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQ
KGLKAVFDEAILTIFHPKKKKKGCLGCHGCCAII
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcagagagaggaccgacagcagctgcggctgcaatggacatgaggagaacagg
atcctgaagtgcgtggtggtcggggacggcgcggtggggaagacctgcttgctgatgagc
tacgccaacgacgccttcccagaggaatacgtgcccactgtgtttgaccactacgcagtt
accgtgacggtgggaggcaagcagcacttgcttggactatacgacactgcaggacaggag
gattacaaccagctgcggccactctcttaccccaacacagatgtgtttctcatctgcttc
tctgtcgtaaacccagcctcttaccacaacgttcaggaggagtgggtcccggaactgaag
gactgcatgcctcatgtgccttatgtgctcatcggaacccagattgatctccgagatgac
cccaaaaccttggcgcgtctgctgtacatgaaggagaagcccctcacctatgagcacggc
gtgaagctggcgaaagcgattggagcgcagtgctacttggaatgttctgccctgacccag
aagggtctcaaagcagtttttgatgaagccatcctcaccattttccaccccaagaaaaaa
aagaaaggctgcttagggtgtcacggctgctgtgcaattatctga

DBGET integrated database retrieval system