KEGG   Mus musculus (mouse): 80859Help
Entry
80859             CDS       T01002                                 

Gene name
Nfkbiz, AA408868, INAP, Mail
Definition
(RefSeq) nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta
  KO
K14242  NF-kappa-B inhibitor zeta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    80859 (Nfkbiz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    80859 (Nfkbiz)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    80859 (Nfkbiz)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    80859 (Nfkbiz)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   80859 (Nfkbiz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 80859
NCBI-ProteinID: NP_001152866
MGI: 1931595
Ensembl: ENSMUSG00000035356
Vega: OTTMUSG00000019996
UniProt: Q9EST8
Position
16; 16 C1.1
AA seq 728 aa AA seqDB search
MIVDKLLDDSRGGEGLLDAAGDCGLMTSPLNLAYFYGASPPSAPGAGDTGYLSAVPSAPG
SPGSDSSDFSSTSSVSSCGAVESRPRGGARAERPQVEPHMGVGRQQRGPFQGVRVKNSVK
ELLLHIRSNKQKASGQPVDEFKTQSVNIEQLTDLKSAVSAVGKRKGPDPLSDGPVCKRPA
LLPSHFVTSPQTPTPGESMEDVRHSESKLDSSAALLQNIINIKNECNPVSLNTVQVSWMS
PTVPQNSPRDQCQDFHGGQAFSPPQKYQPFQVSGSPQMMDQASMYQYSPQTQNMQQPPPL
PPQQQHQQNYPHNSPLQFSPYSRMSQSPKYDSNLFDTHEPQFCTGQSFVSLLTGPGEPES
LAVPVPAPTSIPPQTETQLQTFSLMPSNACEAVVGVHDVGSHSLGTSLSLQNIMGSPMNT
TQLGKSFFQWQVEQEESKLANIPQDQFLARDGDGDTFLHIAVAQGRRALSYVLARKMNAL
HMLDIKEHNGQSAFQVAVAANQHLIVQDLVNLGAQVNTTDCWGRTPLHVCAEKGHSQVLQ
AIQKGAVRSNQFVDLEATNYDGLTPLHCAVVAHNAVVHELQRNRQSHSPEVQDLLLRNKS
LVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGN
TALHVAASLQYRVTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKS
IQQRAPPY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggacaagctgctggacgacagccgcggcggagaggggctgctggacgcggcc
ggcgactgcggcctcatgaccagcccgctcaacctggcttacttctacggcgcctcgcct
ccttccgcccccggcgccggcgacaccggctacctgtccgccgtgccctccgcgcccggc
tcgcccggctccgactcctccgatttctcctccacttcctccgtgtcctcctgcggggcc
gtggagtcccgtcccagaggtggcgcccgcgccgagcgccctcaagttgagccccacatg
ggggttggcaggcagcagagaggcccctttcaaggtgttcgcgtgaagaactcggtgaag
gagctcctgctacacatccgaagcaacaagcagaaggcttccggccagcccgtggatgag
tttaagacacagagtgtgaacattgagcagctgacagacctgaagagtgcagtgtccgca
gtggggaaaagaaagggacccgatcctctgtccgatggaccggtttgcaagaggccagct
ctgttgccttctcacttcgtgacatcaccgcaaacgcctacacctggggagagcatggaa
gatgttcgccacagcgaatccaagctggatagcagcgctgccctgcttcagaatattata
aacatcaagaatgagtgcaacccagtttcactaaacactgttcaggttagctggatgagc
cccacggttccccagaactcgccaagagaccagtgccaggatttccatggaggccaggcc
ttctctccacctcagaaataccaaccgttccaagtcagtggctctccacagatgatggac
caggcgtcaatgtaccagtattcgccacaaacacagaacatgcagcagccgccgccgctg
ccaccacagcagcaacatcaacagaattatccccacaactcacccctgcagttcagtcct
tactccagaatgtcccagtctcccaagtatgattccaacctctttgatactcacgagcca
cagttctgcacgggccaaagttttgtgtctttactgactggcccgggggaacccgagtct
cttgctgttcccgttccggctcccaccagcattccaccccaaactgagactcagctgcag
accttcagcctgatgccaagcaatgcctgcgaggccgtcgtcggggtgcacgatgtgggc
tcgcactctttgggcacgtccctgtcactccagaacatcatgggaagcccgatgaatacc
acccagctggggaagtcattttttcagtggcaggtagagcaggaagaaagcaaattggca
aatattccccaggaccagttcctcgctagggacggagatggtgacacgtttctccatatt
gctgttgcccaagggaggcgagcgctctcgtatgtccttgcaagaaagatgaacgctctt
cacatgctggacattaaggagcacaatggacagagtgcctttcaggtggcggtagctgcc
aatcagcacctcattgtgcaagatctggtaaaccttggtgcccaggtgaacaccacggat
tgctggggaaggacacctctgcatgtctgtgcggagaagggccactcccaggtgctccag
gccatccagaagggagctgtgaggagcaatcagtttgtggatcttgaggcaacgaactat
gatggcctgactcccctacattgcgcggtcgtggctcacaatgcggtggtgcacgaactg
cagaggaatcggcagtctcattcgcccgaagtgcaggacctcttactaaggaataagagc
ctggtagacaccattaagtgtctgattcagatgggagccgcagtggaggcaaaggatcgt
aagagtggccgcacagccctgcacttggcagcggaagaagcaaatctggaactcattcgc
ctctttttggagttgcccagttgcctgtctttcgtgaatgccaaggcttacaatggaaac
accgccctccatgttgctgccagcctgcagtatcgggtgacacagttggacgcagtccgc
ctgttgatgaggaagggagctgaccccagtactcggaacttggagaatgaacagcccgtg
catttggtccccgatggcccagtgggagaacagatccgacgtatcctgaaggggaagtcc
attcagcagcgagcaccaccatactag

DBGET integrated database retrieval system