KEGG   Mus musculus (mouse): 80880
Entry
80880             CDS       T01002                                 

Gene name
Kank3, 0610013D04Rik, Ankr, Ankrd47, D17Ertd288, D17Ertd288e, NG28
Definition
(RefSeq) KN motif and ankyrin repeat domains 3
  KO
K22808  KN motif and ankyrin repeat domain-containing protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    80880 (Kank3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    80880 (Kank3)
SSDB
Motif
Pfam: Ank_2 Ank KN_motif Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 80880
NCBI-ProteinID: NP_109622
MGI: 1098615
Ensembl: ENSMUSG00000042099
Vega: OTTMUSG00000037208
UniProt: Q9Z1P7
Position
17 B1; 17 17.98 cM
AA seq 791 aa
MAKFVLNQNLPDLGGPPLYPGPTGSARSPSSPYSVETPYGFHLDLDFLKYVEEIERGPAS
RRTPGPPHARRPRASRTGLAGARSPGAWTSSESLASDDGGASGALSPGAFPGLSLPPLSP
RSLSRNPRVEHTLLETSRRLEQAQARERALSPARAVTRSPRGSGRSSPAPNPALASPGPA
QLQLVREQMAAALRRLRELEDQARALPELQEQVRALRAEKARLLAGRVQPEQEVEIEARP
DKLAQLRRLTERLATSDRGVRSRASPRAEDPDGLAARRSEGALQVLDPGSRTPDGEPRTR
ETGTEVVPETREVDAQAVPETGEAGVEVVPETVEVDTWVTEELLGLPEAAERELELLRTS
LEHQRGVSELLRGRLRELEEAHEAAVTRPQSRDVAAQTTLGCTEKTTQTELPVENQPRPT
AGDEMAPVGILKSIMKKKDGIPGAQSSQGPKSLQFVGVLNGEYESSSSEDGNSDDEDGVA
EHPRSSSSGSDDSSGGSDAGTPGPHNDKDAGDCELETHPELTAGREGRCELNPRLREACI
ALNQQLNRPRGVTSRDGNAARLVAQEWFRVSSQKRSQAESVAGVLRGVKSLGPELLAYVV
NLADGNGNTALHYSVSHGNLAISSLLLDTGVCDVNHQNRAGYSALMLAALTSVGQEEEDM
AVAQRLFSMGDVNAKASQTGQTALMLAISHGHQDMVAALLECGADVNVQDADGATALMCA
SEYGRLDTVQLLLAQPGCDLTILDNEGTSALAIALEAEQDEVAALLHAHLTSNHQGQSST
GSPTAKECNDK
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggccaagtttgtcctgaatcagaaccttcctgacctgggcggccctcccctgtaccca
ggccccactggaagtgcccgcagccctagctctccctattctgtggagacgccctatggc
ttccacttggacctggacttcctcaaatacgtggaggaaatcgagcgtggccctgcctct
cgccgaactccaggacctcctcatgcacgccgcccgcgcgcgtctcgaacgggcctcgcg
ggagcgcggagcccaggagcttggacttccagcgaatccctggccagtgacgacggcgga
gcctcgggtgcactctctcctggtgcgttcccggggctctcgctacctccgctgtcgcca
cgctccttgtcgcgcaatccgcgcgttgagcacacgctcttggagaccagccgacgactg
gagcaggcgcaggctcgggagcgcgcgctcagcccggcccgcgcagtcacacgcagtccg
cgcgggtccggccgtagcagccccgcccctaaccccgcccttgcctccccgggccctgcc
cagctgcagctagtgagggagcagatggccgcggcgctgcggcgcctgcgtgagctcgag
gaccaggcgcgcgctctgcccgagctgcaggagcaggtgcgcgcgctgcgtgccgagaag
gcgcggctactggccgggcgcgtgcagccagaacaagaagtagagatcgaggcgcgccca
gacaagctcgcccagcttcggcgcctcaccgagcgtctggccacctcggatcgtggagtg
cgctccagggctagcccccgggcagaggatcccgacgggttggctgccaggcgcagcgaa
ggagcgctgcaggtgctcgacccggggtctaggacacccgatggggaaccccggactcgg
gagacgggcaccgaagtcgtgcctgagacccgagaggtggatgcccaggcagtacccgag
acaggggaggctggagtggaggtggtccctgagaccgttgaggtggacacgtgggtgact
gaggagctcctagggttgcctgaggctgcagagcgtgagctggagctgctccgcaccagc
ttggagcatcagcgaggggtgagcgaactcttgcggggccgattgagggagttggaggag
gcccacgaggccgcagtgaccaggcctcagtctcgcgacgttgctgcccagactacattg
ggttgcactgagaaaaccacacagacagagctgccagtggagaaccagcccagacccacg
gctggagacgagatggcccctgttggcatcctcaaatccatcatgaagaagaaagatggt
attccaggtgcacaatccagtcagggacccaagagtctgcagttcgttggggtcctcaac
ggagagtatgagagttcctccagtgaggatggcaacagcgatgatgaagatggtgttgct
gaacaccccaggagtagctcttctggatcagatgatagcagtgggggatctgacgctgga
acccctggcccccacaatgacaaagatgctggggactgcgagcttgagacacatccagag
ctgacggcagggagagaagggaggtgtgaactgaacccccgtttgagggaggcttgcatt
gctctgaatcagcagctgaaccggccacgtggagtcaccagcagagatggcaatgcagca
cgccttgtggcccaggaatggtttcgagtgtccagccaaaaacgctctcaggcagagtct
gtggctggggttcttcgaggggtgaaaagcctggggcctgagctgctggcttatgtggtg
aacctggctgatggcaatggaaacacagctctgcattacagcgtgtctcatgggaatctc
gccatttccagcctgctactggatacaggggtctgtgatgtgaatcaccagaatagagct
ggctactctgccctcatgttggctgcactcacttctgtaggacaagaggaggaagacatg
gctgtggcccagagacttttcagtatgggtgatgtcaatgccaaggctagccagactgga
cagacagccctcatgctggccatcagccatggccaccaggacatggtagctgccttgcta
gaatgcggggctgatgtcaatgtacaggatgctgatggggccacagcactgatgtgtgcc
agcgagtatggacgccttgatacagttcaattgttgttggcccagccaggttgtgaccta
accatcttagacaatgagggcacaagtgccctggccattgcactggaggctgaacaggat
gaggtggctgcactgctccatgcccacctgacatcaaaccaccagggacagtcttccaca
gggtctcccactgcaaaggaatgcaatgacaaatga

DBGET integrated database retrieval system