KEGG   Mus musculus (mouse): 80885Help
Entry
80885             CDS       T01002                                 

Gene name
Hcar2, Gpr109a, Gpr109b, HM74, Niacr1, PUMA-G, Pumag, mHM74b
Definition
(RefSeq) hydroxycarboxylic acid receptor 2
  KO
K08402  hydroxycarboxylic acid receptor 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    80885 (Hcar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    80885 (Hcar2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Hydroxy-carboxylic acid
    80885 (Hcar2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 SpoIIM
Motif
Other DBs
NCBI-GeneID: 80885
NCBI-ProteinID: NP_109626
MGI: 1933383
Ensembl: ENSMUSG00000045502
Vega: OTTMUSG00000054742
UniProt: Q9EP66 Q0VBA6
Position
5; 5 F
AA seq 360 aa AA seqDB search
MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSIC
YNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIIC
FLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcagaccattttctagtgataaacggcaagaactgctgtgtgttccgagat
gaaaacatcgccaaggtcttgccaccggtgttggggctggaatttgtgttcggactcctg
ggcaatggccttgccttgtggattttctgtttccacctcaagtcctggaaatccagccgg
attttcttgttcaacttggccgtggctgactttctcctgatcatctgcctgccgttcctg
acggacaactatgtccataactgggactggaggttcggaggcatcccctgccgtgtgatg
ctcttcatgttggctatgaaccgacagggcagcatcatcttcctcaccgtggtggctgtg
gaccgctacttccgggtggtccatccacaccacttcttgaacaagatctccaaccggacg
gcggccatcatttcttgcttcttgtggggtctcaccatcggcctgactgtccacctcctc
tatacaaacatgatgaccaaaaatggcgaggcatatctgtgtagcagcttcagcatctgt
tacaacttcaggtggcacgatgctatgttcctcttggaattcttcttgcccctggccatc
atcttgttctgctcaggcaggatcatctggagcctgaggcagagacagatggacagacat
gccaagatcaagagggccatcaacttcatcatggtggtggctattgtattcatcatttgc
ttcctacccagtgtggctgtgcgcatccgcatcttctggcttctctacaaatataacgta
cgcaactgtgacatctactcctcggtggacctggctttctttaccacccttagctttacc
tacatgaacagcatgctggaccctgtggtctactatttctccagcccatctttccccaac
ttcttctccacgtgtatcaaccgctgccttcgaaagaaaacattgggtgaacccgataat
aaccgaagcactagtgtggagctcacgggggaccccagcacaaccagaagtattccaggg
gcgctaatggctgaccccagtgagccaggcagccccccttatctggcttccacatctcgt
taa

DBGET integrated database retrieval system