KEGG   Mus musculus (house mouse): 80886
Entry
80886             CDS       T01002                                 
Symbol
Senp3, AA408656, Smt3ip, Smt3ip1
Name
(RefSeq) SUMO/sentrin specific peptidase 3
  KO
K08593  sentrin-specific protease 3 [EC:3.4.22.68]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    80886 (Senp3)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    80886 (Senp3)
   04121 Ubiquitin system [BR:mmu04121]
    80886 (Senp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     80886 (Senp3)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   80886 (Senp3)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   5-FMC complex
    80886 (Senp3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   80886 (Senp3)
SSDB
Motif
Pfam: Peptidase_C48 SENP3_5_N
Other DBs
NCBI-GeneID: 80886
NCBI-ProteinID: NP_001157043
MGI: 2158736
Ensembl: ENSMUSG00000005204
UniProt: Q9EP97
Position
11:complement(69563936..69572910)
AA seq 568 aa
MKETIQGTGSWGPEPPGPGTTYSNPRRERLRWPLPPKPRLKSGGGFGPDPGSGTTVPTRR
LPAPRPSFDASASEEEEEEEEEDEEEVAAWRLPPRWGQLGASQRSRALRPSHRKTCSQRR
RRAMRAFQMLLYSKSTSLTFHWKLWGRHRGRRRNLAHPKNHLSPQEGGATPQVPSPCCRF
DSPRGLPPPRLGLLGALMAEDGMRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLP
NGFGGLSGPEGERSLAPPDASILISNVCSIGDHVAQELFQSSDLGIAEEADRTGEKAGQH
SPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKSLVLQLIQS
YQRMPGNAMVRGFRVSYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFN
SFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRT
LNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALS
QPFSFTQQDMPKLRRQIYKELCHCKLTV
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaaagagactatacaggggaccgggtcttgggggcctgagcctccgggacccggcacc
acttactcaaatcccaggcgagagcgtcttcgttggcccctaccccctaagccccggctc
aagtccggtggtggttttgggccagatcctgggtctgggaccacagtgccaactagacgc
ctccctgccccccggccatcttttgatgcctcagctagtgaagaagaggaagaggaagag
gaggaagatgaggaggaagtagcagcttggaggctaccccctaggtggggccaactgggg
gcctcccagcgctctcgagctctccgaccctctcatagaaaaacctgctcacagcgccgg
cgccgagccatgagagccttccagatgctgctctactcaaaaagcacctcgctgacattc
cactggaagctttgggggcgccaccgaggccggcggcggaacctcgcgcaccccaagaac
catctctcaccccaggaagggggtgcaacgccacaggtgccatcaccctgctgtcgtttt
gactccccccgggggctacccccaccccggctgggtctgctaggtgctctcatggcagag
gatgggatgagagggtctccaccagtgccctctgggccccccatggaggaagatggacta
aggtggaccccaaagtctcctctggaccctgactcgggcctcctctcatgtactctaccc
aatggttttgggggactgtctggtcctgaaggggagcgcagcctggcaccccctgatgcc
agcatactcatcagtaatgtgtgcagcattggagaccacgtggctcaggaactttttcag
agctctgacttgggcattgcagaagaggcagatcggactggggagaaagctggccagcat
agcccccttcgggaggaacatgtgacctgtgtgcagagtatcttagatgaattccttcaa
acttatggcagcctcatccctctcagcactgatgaagttgtagagaagttggaggacatt
ttccagcaggagttctctacaccctcaaggaagagtctggtactacagctgatccagtct
tatcagcggatgccaggcaacgctatggtaaggggcttccgggtatcctataagcgacac
gtgctcaccatggatgacttgggtaccttatatggacagaactggctcaatgaccaggtg
atgaacatgtatggagatctggtcatggacacagtccctgaaaaggtgcatttcttcaac
agcttcttctatgataaactccgtaccaagggttatgatggggtaaagaggtggaccaaa
aatgtggacatcttcaataaggaattactgctaatccccatccatctggaggtgcactgg
tcccttatctcagttgatgtaaggcgacgtaccatcacctattttgactcccagcgaact
ctaaatcgccgctgccctaagcatattgccaagtatctacaggcagaggcagtcaaaaaa
gaccgactggacttccatcagggctggaaaggttacttcaaaatgaatgtggccaggcag
aataatgacagtgactgtggtgcctttgtattacagtactgcaagcacctggccctgtct
cagccattcagcttcacccagcaggacatgcccaaactccgtcgtcagatctacaaggaa
ctgtgtcactgcaaactcactgtgtga

DBGET integrated database retrieval system