KEGG   Mus musculus (mouse): 80888Help
Entry
80888             CDS       T01002                                 

Gene name
Hspb8, AU018630, AW413033, Cryac, D5Ucla4, E2IG1, H11, H11K, HSP20-like, HSP22
Definition
(RefSeq) heat shock protein 8
  KO
K08879  heat shock protein beta-8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    80888 (Hspb8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    80888 (Hspb8)
   04131 Membrane trafficking [BR:mmu04131]
    80888 (Hspb8)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  H11 family
   80888 (Hspb8)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   80888 (Hspb8)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    80888 (Hspb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20 YabP
Motif
Other DBs
NCBI-GeneID: 80888
NCBI-ProteinID: NP_109629
MGI: 2135756
Ensembl: ENSMUSG00000041548
Vega: OTTMUSG00000014696
UniProt: Q9JK92
Position
5 F; 5 56.41 cM
AA seq 196 aa AA seqDB search
MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAW
PGTLRSGMVPRGPPATARFGVPAEGRSPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVE
VSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPATVFASLSPEGLLIIEAPQVPPYSPFGES
SFNNELPQDNQEVTCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgggcaattgcctttcccgtgctcctacccaagccgcctgcgccgagacccc
tttcgggactcaccgctctcctcccgccttctggacgatggctttggcatggaccctttt
ccagacgacttgacagccccttggccagagtgggctttgcctcggctctcctctgcctgg
cctggaaccctaaggtctggcatggtaccccgagggcctccagccacagctaggtttgga
gtgcccgctgagggcaggagtcccccacccttccctggggagccttggaaagtgtgtgtc
aacgtgcacagcttcaagccggaagagctgatggtaaagaccaaggatggatacgtggaa
gtttcaggcaaacatgaagagaagcagcaggaaggtgggattgtctccaagaacttcacc
aagaaaatacagctccctgcagaagtggatccagccactgtatttgcctcgctttctcca
gagggcctgctcatcatcgaggctccccaggtccctccgtactcaccctttggagagagc
agcttcaacaacgagcttcctcaagacaaccaggaagtcacctgttcctaa

DBGET integrated database retrieval system