KEGG   Mus musculus (mouse): 80898
Entry
80898             CDS       T01002                                 

Gene name
Erap1, A-LAP, ARTS-1, Arts1, ERAAP, PILSA, PILSAP
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    80898 (Erap1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     80898 (Erap1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M1
   80898 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 80898
NCBI-ProteinID: NP_109636
MGI: 1933403
Ensembl: ENSMUSG00000021583
UniProt: Q9EQH2
Position
13; 13 C1
AA seq 930 aa
MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPEYMTPIHYDLMIHANL
STLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEMLSEEPLKVLEYPAHEQV
ALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEMRILAATQFEPTAARMAF
PCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIEDHFDITVKMSTYLVAFII
SDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
MFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGT
QTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQKGFPLITITVSGRNVHMKQEHYMK
GSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVQWIKFNVGMNGYYIVH
YADDGWASLSGLLKEAHTTISSNDRASLINNAFQLVSIEKLSIEKALDLTLYLKNETEIM
PIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKDLIDKQTWTDEGSVSERMLRSQL
LLLACVRNYQPCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQS
SLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWK
FLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQT
IETIEENIRWMDKNFDKIRLWLQKEKPELL
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgccctctcttcttcccctagtattgacatttttatctgtgtcatctccttcttggtgt
cagaacagtgatatagaatctctaaaagctagtaatggagactcattcccttggaataat
atgcgacttcctgagtatatgaccccgattcattatgatctcatgatccatgcaaacctc
agcactctgactttctggggaaaaacagaagtagaaatcatagctagccggcccaccagc
accattattatgcatagtcaccacctgcaaatatctaaggccaccctcagaagaggagct
ggagagatgctgtctgaagaaccactgaaggtcctggaatatcctgctcatgagcaagtt
gcactgctggctgcccagccgcttcttgctgggtccctgtacacagttatcatcgactat
gctgccaacctgtctgagagtttccatggattctataagagcacctacagaacacaggaa
ggtgaaatgagaatacttgcagcaacacagtttgaacccacagctgctagaatggctttt
ccctgctttgatgaacctgccctcaaggcaagtttttccatcaagataaagagggatcca
aggcacctggccatctccaacatgcccctggtgaaatctgtgaatgttgctgaaggactc
atagaagaccattttgacatcactgtgaagatgagtacctacctagtggccttcatcatt
tctgattttaagtctgtgagcaagatgactaagagtggagtcaaggtttctgtgtatgct
gtgccagacaagataaatcaagccgattatgctctggatgctgcagtgactcttctagag
ttttatgaggattatttcaacattccatatcctttacccaagcaagatcttgctgcaatc
ccagactttcagtctggtgctatggaaaactggggactgaccacatacagagagtcctct
ctgttatacgataaagaaaagtcttctgcatctagtaagcttggcatcacaatgattgtg
tcccatgaactggctcaccagtggttcgggaacctggtcaccatggaatggtggaatgac
ctttggctcaatgaaggatttgccaaatttatggagtttgtgtctgtcactgtgacccat
cctgaactaaaagttgaagactatttctttggcaagtgttttaatgcaatggaagttgat
gcattaaactcctctcaccctgtatccacacctgtggagaatcctgcgcagattcgggag
atgtttgatgatgtttcttatgaaaagggagcttgtattctgaatatgctaagagattat
ctgagtgcagatacatttaaaagaggaattgtacagtatctccaaaagtatagttataaa
aacacaaaaaacgaggacctgtggaatagcatgatgcatatttgccctacagatggcaca
caaacaatggatggcttctgctctagaagccaacactcatcatcaacctcacactggcgt
caggaggttgtagatgtaaagaccatgatgaacacatggacactgcagaagggctttcct
ctgataaccatcactgtgagtgggcggaatgtgcacatgaagcaagaacactacatgaag
ggttcagaacgcttcccagagactgggtatttgtggcatgttccactgacattcattacc
agcaaatcagactcagtccagagatttttgctgaagacaaagacagatgtgctcatcctc
ccagaagcagtgcagtggatcaaatttaacgtgggaatgaatggctattacattgtgcat
tacgcggatgatggatgggcttctctgagtggccttttaaaagaagcgcacacaacaatc
agcagtaatgatcgggcaagtctcatcaacaatgcatttcagctggtcagcattgaaaag
ttatcaatagaaaaagccctggatttaaccctgtacttgaaaaatgaaactgaaattatg
cccatattccaagctttgaatgaactcatacctatgtataagttaatggagaaaagagat
atgattgaggtggaaactcaatttaaggacttccttctcaagttgctgaaggaccttatt
gataagcagacttggacagatgaaggctctgtctcagagaggatgctcaggagccagctc
ctcctcctcgcatgtgtgcgcaattatcagccctgtgtgcagagggcagagcgctatttc
agagagtggaagtcatctaatggaaacatgagcatccctattgatgtgaccttggctgtg
tttgctgtcggggcccaaaacacagaaggctgggattttctttatagtaaatatcagtct
tctttgtctagtactgagaaaagccaaattgaattttccctctgtacaagcaaagatcca
gaaaaacttcagtggcttctagatcaaagttttaagggagagataataaaaactcaggaa
tttccacatattctcacactcattggcagaaacccagtgggttatccattggcctggaag
tttctgagggaaaattggaataagcttgtacagaaatttgaacttggctcatcgtccata
gctcacatggtaatgggaacaacagaccagttttccaccagagcacgtcttgaagaggta
aaaggattcttcagttccttgaaagaaaacggttctcagctccgttgtgttcaacaaacc
attgagaccattgaagaaaacatacgatggatggataagaattttgataaaataagactg
tggctgcaaaaagaaaagccagagttgctgtga

DBGET integrated database retrieval system