KEGG   Mus musculus (mouse): 80904
Entry
80904             CDS       T01002                                 

Gene name
Dtx3, Deltex3, mg310
Definition
(RefSeq) deltex 3, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    80904 (Dtx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    80904 (Dtx3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     80904 (Dtx3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    80904 (Dtx3)
SSDB
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-rbx1 zf-RING_5 zf-Nse Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-ANAPC11 zf-RING_11 DUF1644 FdhE
Other DBs
NCBI-GeneID: 80904
NCBI-ProteinID: NP_109639
MGI: 2135752
Ensembl: ENSMUSG00000040415
Vega: OTTMUSG00000033472
UniProt: Q80V91
Position
10; 10 D3
AA seq 347 aa
MSFVLSRMAACGGSCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPELHRP
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREDAEEQETTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtcgttcgtcctgtccagaatggcagcctgtggaggctcctgcaagaacaaagtgact
gtctccaagcctgtgtgggacttcctgagcaaggagaccccagcccggctggcccggctt
cgggaggagcatcgggtgtccatcctcatagatggcgagacttctgacatctacgtgctc
cagctgtccccacagggtcctcccccagcccctcccaatgggctctacctggccaggaag
gctctcaaggggctactgaaagaggcagagaaagagctaaagaaagcccagaggcagggg
gagctcatgggctgcctggctttggggggtggaggggaacaccccgagctgcaccgccca
ggccctcctcccctccgagcagccccactcctgcccccaggggcaagagggctaccccct
cctcctcctcccctgccccctccactccctcctcgtctcagagaggacgctgaagagcag
gaaaccacctgccccatttgcctgggggagatacagaatgccaagacgctggagaagtgc
aggcactccttctgtgagggctgcatcacacgggccctgcaggtgaaaaaggcctgcccc
atgtgcggccgattctacgggcagcttgtgggcaaccagccccagaacggacggatgctg
gtctccaaggatgccaccctcctgctgcccagctacgagaagtatggcaccattgtcatc
caatatgtcttcccgcctggcgtccagggggctgaacaccccaacccaggagttcggtac
cctggtaccacacgggtggcctacctcccggactgccccgagggcaacaaggtgctgacc
ctgttccgaaaggcatttgaccagcgcctcaccttcaccatcggcacgtccatgactaca
gggagacccaatgtcatcacttggaacgacatccaccacaagaccagctgcacaggggga
ccccagctgtttgggtatccggacccaacctacctgactagggtgcaagaggaactgaga
gccaagggtatcacagacgactga

DBGET integrated database retrieval system