KEGG   Mus musculus (house mouse): 80905
Entry
80905             CDS       T01002                                 
Symbol
Polh, RAD30A, XPV
Name
(RefSeq) polymerase (DNA directed), eta (RAD 30 related)
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    80905 (Polh)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    80905 (Polh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    80905 (Polh)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     80905 (Polh)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    80905 (Polh)
SSDB
Motif
Pfam: IMS zf_UBZ IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 80905
NCBI-ProteinID: NP_109640
MGI: 1891457
Ensembl: ENSMUSG00000023953
UniProt: Q9JJN0
Position
17:complement(46482281..46513567)
AA seq 694 aa
MAPGQNRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVT
RNMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSYFAVIERASIDEAYID
LTSAVQERLQKLQGQPISADLLPSTYIEGLPRGPTVEETVQKEAIRKQGLLQWLDSLQSD
DPTSPDLRLTVGAMIVEEMRAAIESKTGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHG
SVPQLFSQMPIRKIRSLGGKLGASVIEVLGIEYMGDLTQFTESQLQSHFGEKNGSWLYAM
CRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLALELEERLTKDRNDNDR
VATQLVVSIRFQGDRRLSSLRRCCALPRYDAHKMSQDAFAAIRNCNTSGIQTEWSPPLTM
LFLCATKFSAAAPPACTDITAFLSSDSSCQPKVPIASSETRTQGSGPAVPTSKEAATSLA
SFFQKAAKKQRMKETSFVPLNTATEKLSSKPSLVFQSSQTTGSQSFFKQKSLLLQHTQLS
NSAAPDPPQASPAAQPSCLPAECVDSGPDDGAVKPVSSKAVSTEMNVAGDSPNVLDSPAY
NSQEVTQRATEDQVLCEKCDSLVPVWDMPEHTDYHFALELQKSFLQPCTSKPQAIPAVSP
QGKRNPKSPSASSSKRLRPHGMQTLESFFKPLTH
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggctcctgggcagaatcgagtggttgctcttgtagacatggactgcttttttgtacaa
gtggaacagcggcaaaatcctcatttgaggaataaaccttgtgcagttgtacagtacaaa
tcatggaaaggtggtggaattattgcagttagctatgaagcccgagcatttggtgtcact
agaaacatgtgggcggatgatgctaagaagttatgtccagatcttctcctggcacaagtt
cgtgagtcccgtggaaaagctaacctcaccaagtaccgggaagctagtgttgaagtgatg
gagataatgtcttattttgctgtgattgaacgtgccagcatcgatgaggcttatatagat
ttgaccagtgctgtacaagaaagacttcaaaagttacaaggtcagcctatctcagcagat
ttgctgccaagcacttacattgaagggttgccccgaggccctacagtagaagagactgtt
cagaaagaggctattcggaaacaaggcttgcttcagtggcttgattctcttcagagtgat
gatcccacctctccagacctcaggctgactgtgggagccatgattgtggaagaaatgaga
gcagccatagagagtaagactggcttccagtgttcagctggaatctcacacaataaggtc
ctggcaaaacttgcttgtggactaaataagcccaaccgccaaaccctggtctcacatggg
tcagtgccacagctcttcagccagatgccaatccgtaaaatccgaagtcttggaggaaag
ctaggggcttctgtcattgaagtccttgggatagaatacatgggtgacctgacccagttc
actgaatcccagctccagagtcattttggagagaagaatgggtcttggctgtatgccatg
tgtcgaggtattgaacacgatccagttaaacccaggcagttacctaaaactattggctgc
agcaagaacttcccagggaaaacagctctggctactcgggagcaggtacagtggtggctt
ttgcagttagctctggaacttgaggagaggctaaccaaagatcgaaatgataatgaccgc
gtggccactcagctggtcgtcagtattcgttttcagggagacaggcgtctcagcagcctg
cggcggtgctgtgccctccctcgctatgacgctcacaagatgagccaggacgcatttgct
gccatcaggaactgtaatacatctggaatccaaactgagtggtcccctcctctcacaatg
ctcttcctctgcgctaccaagttctctgcggctgcccctccagcttgcacggatatcact
gcgttcctgagtagcgactcaagttgtcagccaaaggtgccaattgccagctctgagact
aggacccaggggtctggcccagctgtaccaacctctaaagaggcagccacatctctagcg
tctttttttcaaaaagctgccaaaaagcagagaatgaaagagacttcctttgtacctctt
aacacagccacagagaagttatcatccaagccttcacttgtgttccaaagcagccaaacc
acaggaagtcagtctttctttaagcagaagagcctgctgctccagcacacacagcttagt
aactctgcggctcctgaccctccacaggccagccctgcagcgcaaccaagctgtctgcca
gcagagtgtgtagacagtggtcctgatgatggagcggtgaagccagtatcctctaaagca
gtgtctacagaaatgaatgtggctggggacagtccaaacgtgctcgattctccagcttac
aactctcaggaggtgacccaaagggccactgaggaccaagtgctctgtgagaagtgtgac
tccctggttccagtgtgggacatgccagaacacacggactaccattttgcattggagttg
cagaagtcttttttgcagccttgtacttcaaaaccccaggctattcctgccgtgtctcct
cagggcaaaagaaatcccaagagtccctcggcttccagtagtaagcgccttaggccccat
ggcatgcagacgctggaatcgttttttaagccactgacacattag

DBGET integrated database retrieval system