KEGG   Mus musculus (mouse): 80913Help
Entry
80913             CDS       T01002                                 

Gene name
Pum2, 5730503J23Rik, Pumm2
Definition
(RefSeq) pumilio RNA-binding family member 2
  KO
K17943  pumilio RNA-binding family
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    80913 (Pum2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PUF PC4 FYVE_2
Motif
Other DBs
NCBI-GeneID: 80913
NCBI-ProteinID: NP_001153691
MGI: 1931751
Ensembl: ENSMUSG00000020594
Vega: OTTMUSG00000035455
UniProt: Q80U58
Structure
PDB: 

Position
12; 12 A1.1
AA seq 1066 aa AA seqDB search
MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGTSHHSMSQP
IMVQRRSGQSFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGTFGTRD
AETDGPEKGDQKGKASPFEEDQNRDLKQDDEDSKINGRGLPNGMDADCKDFNRTPGSRQA
SPTEVVERLGPSTNPPEGLGPLPNPTANKPLVEEFSNPETQNLDAMDQVGLDSLQFDYPG
NQVPMDSSGATVGLFDYNSQQQLFQRTSALTVQQLTAAQQQQYALAAAQQPHIAGVFSAG
LAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPWGVYPANLFQQQ
AAAAASNTANQQAASQAQPGQQQVLRPGAGQRPITPSQGQQGQQAESLAAAANPTLAFGQ
SLAAGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSTAAQAAAAAA
AAGGTANSLTGSTNGLFRPIGTQPPQQQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFS
HGPGQPGSASLGFGSGSSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSS
SLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSSLHLGGLTNGSG
RYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRSDIMPSGRSRLLEDFRNNRFP
NLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQIVFNEILQAAYQLMTDVFGNYVI
QKFFEFGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQVISEMVKELDGH
VLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAE
QTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASN
VVEKCVTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKII
MHKIRPHITTLRKYTYGKHILAKLEKYYLKNSPDLGPIGGPPNGML
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgattttcaagctcttgcattagaatctcggggaatgggagagcttttgcct
accaaaaagttttgggaacctgatgattcaacaaaagatggacaaaaaggcatatttctt
ggggatgatgaatggagagagactgcatggggaacttctcatcattcaatgtcccagcct
attatggtgcagagaagatctggacagagttttcatggaaacagtgaagtaaatgcaatt
ctttctccacgctcagaaagtggaggccttggtgtgagcatggtagaatatgtattaagt
tcctctcctgctgataaattggattctcgatttaggaagggaacttttggtactagagat
gctgaaacagatggacctgagaaaggagatcaaaaaggcaaggcttctccatttgaggag
gaccaaaacagagatcttaaacaagatgatgaggactctaaaataaatggcagaggtttg
ccaaatggaatggatgccgattgcaaagattttaatcgcactcctggaagtcgccaagcc
tctccaactgaagtagttgagcgccttggccctagtactaatcccccagaaggattgggc
cctcttcctaatccgacagcgaataaaccacttgttgaagaattttcaaaccctgaaact
cagaatctggatgcaatggaccaagttggtctggattccttacagtttgactatcctggt
aatcaggtacccatggattcttcaggagctactgtaggcctttttgactacaattcccaa
cagcagctctttcagaggactagtgcactaacagttcagcagttaactgcagctcagcag
cagcagtatgcattagcagcagctcagcagccacatatagctggtgtattctcagcaggc
cttgctccagctgcatttgtgccaaatccatatattattagtgctgctcctccagggact
gacccgtatactgcagcaggattggctgcagcagcaacattagcaggtccagcagtggtt
ccacctcagtattacggtgttccatggggagtgtatccagccaatttatttcagcaacaa
gctgcagctgcggcaagcaacacagccaaccagcaagcagcatcacaagctcagcctgga
cagcagcaggttcttcgtcctggagcaggtcagcgtcctattactccaagtcagggccaa
caagggcagcaagcagagtcacttgcagcagctgcaaacccaactttggcttttggtcag
agtcttgctgcaggcatgccaggctatcaagtactagctccaactgcctattatgatcag
actggtgccttagtggttggccccggagcaagaactggccttggagctccagtacgatta
atggctccaacacctgtcttaataagttcaacagcagcacaagctgcagcagcagcagca
gcagctggaggaactgcaaatagtcttacaggcagcacaaatggtctgtttcggccaatt
ggcactcagccaccacagcagcagcagcagcagcagcaaccaagcactaacctgcagtct
aattcattttatgggagcagctctttgactaacagctcccagagcagctctttattctct
catggacctggccaacctggaagtgcgtctcttggctttggaagtggtagctctttagga
gctgctataggctcagctctcagtggatttggctcatcagttggcagttctgcaagtagt
agtgccacaaggagagagtctctatctactagctctgacttgtacaaaagatctagtagc
agcctagcacccatagggcaaccattttacaatagtctgggattttcctcctctccaagt
ccaataggcatgcctctgccaagccaaactccaggacattcacttacgccaccgccatca
ctttcatcacatggatcctcatccagtttgcatttaggaggactgacaaacggtagtggt
cggtatatctctgcagcacctggagcagaagcaaagtaccgaagtgcttcaagcacttcc
agtctatttagctccagcagccagctctttcctccttctcggctccgctataatagatct
gacatcatgccctccggccgcagtaggttattggaagatttcaggaacaaccgcttcccc
aaccttcagctcagagacttaattggacatatagtcgagttttctcaagaccagcatggt
tccagattcatacagcaaaagctagagagagctactccagctgagcgacaaatagtattt
aatgaaattctacaggcagcctatcaattaatgacagatgtttttggaaactatgttata
cagaagttttttgagtttggaagtttggatcagaaattagccctggctactcgtattcgt
ggtcatgttctaccattagccttgcagatgtatggctgccgtgttattcaaaaggcgtta
gaatctatttcttctgatcagcaggtaattagtgaaatggttaaggaactagatggccat
gtacttaaatgtgtgaaagatcaaaatggaaaccatgttgtacagaaatgcattgaatgt
gttcagccacagtcactgcagttcatcatcgatgctttcaaaggacaagtatttgtgctt
tcaacccatccttatggctgcagagtcattcagcgtatcttagagcactgcacggcagag
cagaccttacccatcttagaagaacttcaccaacacacagaacagttggtacaggatcag
tatggcaattatgttattcagcatgtactggaacatggtcgacctgaagacaagagcaaa
attgtttccgaaatcagaggaaaggtcttagccctgagtcaacacaaatttgccagcaat
gtagtagaaaagtgtgttactcatgcctcccgtgctgagagagctttactgattgatgag
gtctgctgtcagaatgatggtcctcacagtgccttatacaccatgatgaaggatcagtat
gccaactatgtggttcagaagatgattgatatggctgagcctgcgcagagaaagataatc
atgcacaagattcgacctcatattactactcttcgcaaatacacatatgggaagcatata
ctggccaagttggaaaaatactatctgaaaaacagcccagatctagggccaattggagga
ccaccaaatgggatgctgtaa

DBGET integrated database retrieval system