KEGG   Mus musculus (mouse): 80914
Entry
80914             CDS       T01002                                 

Gene name
Uck2, AA407809, AI481316, AU018180, AU020720, TSA903, UK, UMK, Umpk
Definition
(RefSeq) uridine-cytidine kinase 2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    80914 (Uck2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    80914 (Uck2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     80914 (Uck2)
SSDB
Motif
Pfam: PRK CoaE AAA_18 Zeta_toxin Cytidylate_kin T3SS_needle_reg
Other DBs
NCBI-GeneID: 80914
NCBI-ProteinID: NP_109649
MGI: 1931744
Ensembl: ENSMUSG00000026558
Vega: OTTMUSG00000050631
UniProt: Q99PM9 Q543C2
Position
1; 1 H2.3
AA seq 261 aa
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRK
EETVTIYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQTNG
YLNGYTPSRKRQASESSSRPH
NT seq 786 nt   +upstreamnt  +downstreamnt
atggccggggacagcgagcagaccctgcagaaccaccagcagcccaacggcggcgagccc
ttcctgatcggcgtgagcgggggcacggccagcgggaagtcttccgtttgtgctaagatc
gtccagcttttggggcagaatgaggtggattaccaccagaagcaggtggtgatcctgagc
caggatagcttctaccgagtcctcacctcagagcagaaggccaaagccctcaagggccaa
ttcaactttgatcacccggatgcctttgacaacgaactcatcttcaaaacactcaaagaa
atcaccgaaggaaaaaccgtccagatccccgtgtacgactttgtctcccactcacggaaa
gaggagacggtcaccatctaccccgccgacgtggtgctcttcgaagggatcctagccttc
tattcccaggaggtccgagacctgttccagatgaagctttttgtggacacagatgcggat
acccgtctgtctcgccgagtattgagggacatcagcgaaagagggagggaccttgagcag
attttatcacagtacattacgtttgtgaagcctgcctttgaggaattctgcttgccaaca
aagaaatacgccgatgtgatcattcctagaggtgccgacaatctcgtggccatcaacctc
atcgtgcaacacatccaggacatcctcaacggggggctctccaagcggcagacgaacggc
tatctcaacggctacaccccttcccgcaagaggcaggcgtcagagtccagcagccgacca
cattga

DBGET integrated database retrieval system