KEGG   Mus musculus (mouse): 80915
Entry
80915             CDS       T01002                                 

Gene name
Dusp12, 1190004O14Rik, AA027408, AW049275, ESTM36, LMW-DSP4, T-DSP4, VH1, mVH1
Definition
(RefSeq) dual specificity phosphatase 12
  KO
K14819  dual specificity phosphatase 12 [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    80915 (Dusp12)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    80915 (Dusp12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     80915 (Dusp12)
    3.1.3.48  protein-tyrosine-phosphatase
     80915 (Dusp12)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    80915 (Dusp12)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    80915 (Dusp12)
SSDB
Motif
Pfam: DSPc Init_tRNA_PT Y_phosphatase PTPlike_phytase
Other DBs
NCBI-GeneID: 80915
NCBI-ProteinID: NP_075662
MGI: 1890614
Ensembl: ENSMUSG00000026659
Vega: OTTMUSG00000035839
UniProt: Q9D0T2 Q4KL39
Position
1; 1 H3
AA seq 339 aa
MLEAQGSNHGCERQAPTASPASSAGHAVEVRPGLYLGGAAAVAEPGHLREAGITAVLTVD
SEPAFPAGAGFEGLRSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSR
SVAVVMAFIMKTDQLTFEKAYDILRTVKPEAKVNEGFEWQLKLYEAMGYEVDTSSAFYKQ
YRLQKVTEKCPKLWNLPQELFAVDPTTISQGLKDDILYKCRKCRRSLFRHSSILGHSEGS
GPIAFAHKRTAPSSVLTTGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCSAKLGSFN
WYGEQCSCGRWITPAFQIHKNRVDEMKMLPVLGSQTKKL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgttggaagcgcagggttctaaccatggctgcgagcgccaggctccgactgccagtccc
gccagctcggcagggcacgccgtggaagtgcggcccgggctgtatctgggtggggcagcg
gcagtggcggaaccgggccatctgagggaggcgggcatcaccgccgtgctgacggtggac
tctgaaccggctttcccggctggggctgggttcgaaggtctccggagcctcttcgtgccg
gcgctggacaaacccgagaccgacctgctcagccacctggatcgctgcgtggccttcatc
ggccaggctcgctccgaaggccgcgcggtgttggtgcactgtcatgcaggagtcagtcgc
agtgttgctgtagtgatggcttttataatgaagaccgaccagcttacctttgaaaaagcc
tacgacatcctccggacggtcaagccagaggctaaagtgaatgaggggtttgaatggcaa
ctgaaactgtatgaggcaatgggatacgaagtcgatacgtccagtgccttttacaagcag
taccgtttacaaaaggtgactgagaagtgtccaaaactttggaatttacctcaggaactc
ttcgctgttgacccaactaccatttcacagggattaaaagatgacattctctacaaatgc
agaaaatgcaggcggtctttatttagacattctagtattttgggtcatagtgaaggaagt
gggccaatagcctttgctcacaagagaacggcgccatcttctgtacttaccacagggagt
caggctcagtgcacgtcttacttcattgagcctgtgcagtggatggaatctactctgttg
ggcgttatggatggacagcttctttgcccaaaatgcagtgccaagttgggttcctttaac
tggtatggtgaacagtgctcctgtggtcgatggataacccctgcttttcaaatacacaag
aacagagtggatgaaatgaaaatgttgccggtgctgggatcacagacaaagaagctgtga

DBGET integrated database retrieval system