KEGG   Mus musculus (mouse): 80976
Entry
80976             CDS       T01002                                 

Gene name
Syt13, 5730409J20Rik, AI549909, mKIAA1427
Definition
(RefSeq) synaptotagmin XIII
  KO
K19913  synaptotagmin-13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    80976 (Syt13)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    80976 (Syt13)
SSDB
Motif
Pfam: C2 PI3K_C2
Other DBs
NCBI-GeneID: 80976
NCBI-ProteinID: NP_109650
MGI: 1933945
Ensembl: ENSMUSG00000027220
Vega: OTTMUSG00000014492
UniProt: Q9EQT6
Position
2; 2 E1
AA seq 426 aa
MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDREPDPEKARPGVLQAAQ
QFNIKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLETTEESAAPASPQAQSDS
RLKRQVTEELSIRPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTSL
EAVTSDHEGGCDCYIQGSVAVKTGSVEAQTALKKRQLHTTWEEGLALPLGEEELPTATLT
LTLRTCDRFSRHSVIGELRLGLDGASVPLGAAQWGELKTTAKEPSAGAGEVLLSISYLPA
ANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMI
MFELPDDLLRASSVELEVLGQGEEGPSCELGHCSLGLHASGSERSHWEEMLKNPRRQIAM
WHQLHL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggtgctgtcggtgcctgtgatcgcgctgggcgccacgctgggcactgccaccagcatc
cttgcgctgtgcggggtcacttgcctgtgccgacacatgcaccccaagaaggggttgctg
ccgcgggaccgtgagcccgacccggagaaggcaaggcccggtgtgcttcaggcggcccaa
cagttcaacattaaaaagtccacggagcctgtccagccccgacctctccttaagttcccg
gacatctatggtccccggccagccgtgacggccccagaagtcatcaactacgcagactac
accttggagaccacagaggagtctgctgcacctgccagcccccaggcccagagtgacagt
cgcctcaagaggcaggtcacagaggagctgtccatccgtcctcagaacggtgtagttgag
gatgtctgtgtcatggagacctggaacccagagaaggctgccagctggaaccaggccccc
aaactccacttccgcctggactatgaccagaagaaggctgagttatttgtgacaagcctg
gaagctgtcaccagtgaccatgaaggaggctgtgactgttacatccaaggcagcgtggct
gtcaagaccggctctgtggaggcacagacagctctgaagaagcggcagctgcacacaacc
tgggaggagggcctggccctgcccctgggtgaggaagagctccccacagctaccctgaca
ctcaccctgcgcacctgtgaccgcttctcccgccatagtgtgattggggaactccgcctg
ggcctggatggagcatctgtacccctgggggcagcacagtggggtgagctgaagaccaca
gcaaaggagccatctgcaggggccggggaggtccttctgtcaatcagctacctcccagct
gccaatcgcctcctggtggtgctgattaaagctaagaacctccactccaaccaatccaag
gagctgctgggcaaggatgtgtctgtcaaggtgaccttgaaacaccaggctcagaagctg
aagaagaaacagacaaaacgggccaagcacaagatcaaccccgtgtggaacgagatgatc
atgtttgagctaccggatgacttgctgcgggcatccagtgtggagctggaggtgctgggc
cagggcgaggaggggccgagctgcgagctgggccactgcagcctaggcctgcatgcctcg
ggctctgagcgcagccactgggaggagatgctaaaaaacccacgccggcagatcgccatg
tggcaccaactgcacctgtag

DBGET integrated database retrieval system