KEGG   Mus musculus (mouse): 81000Help
Entry
81000             CDS       T01002                                 

Gene name
Rad54l2, Arip4, D130058C05, G630026H09Rik, Srisnf2l
Definition
(RefSeq) RAD54 like 2 (S. cerevisiae)
  KO
K10876  RAD54-like protein 2 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    81000 (Rad54l2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     81000 (Rad54l2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     81000 (Rad54l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII Leuk-A4-hydro_C
Motif
Other DBs
NCBI-GeneID: 81000
NCBI-ProteinID: NP_109655
MGI: 1933196
Ensembl: ENSMUSG00000040661
Vega: OTTMUSG00000049429
UniProt: Q99NG0 E9QKL0
Position
9; 9 F1
AA seq 1467 aa AA seqDB search
MSDESASGSDPDLDPDVELEDEEEEEEEEEEVAVEEHDRDDEEGLLDDTSLEGMCGTEHA
QLGEDGQRPPRCTSTTSSQSEPSEQLRHQGKILASEDPKKKRAQKPSHMRRNIRKLLRED
QLEPVTKAAQQEELERRKRLEQQRKEYAAPIPTVPLEFLPEEIVLRASDGPQLPPRVLAQ
EVICLDSSSGSEDEKSSRDEVIELSSGEEDTLHIVDSSESVSEEDEEEEKGGTHVNDALN
QHDALGRVLVNLNHPPEEENVFLAPQLARAVKPHQIGGIRFLYDNLVESLERFKTSSGFG
CILAHSMGLGKTLQVISFIDVLFRHTPAKTVLAIVPVNTLQNWLAEFNMWLPAPEALPAD
SKPEEVQPRFFKVHILNDEHKTVASRAKVTADWVSEGGVLLMGYEMYRLLTLKKSLATSR
PKKTKKRSHPVIIDLDEEDRQQEFRREFEKALCRPGPDVVICDEGHRIKNCQASTSQALK
NIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQEFSNMFERPILNGQCIDSTPQD
VRLMRYRSHVLHSLLEGFVQRRGHTVLKIHLPAKEENVILVRLSQIQRDLYTQFMDRFRD
CGTSGWLGLNPLKAFCVCCKIWNHPDVLYEALQKENLANEQDLDVEELGSAGTSARCPPH
GTKVKGEDSALPSSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKELLTNYQTGVLENS
PKMVLLFHLIEESVKLGDKILVFSQSLSTLALIEEFLGKRDMPCLPGAEGQGTQKWVRNV
SYFRLDGSTPAFERERLINQFNDPSNLTTWLFLLSTRAGCLGVNLIGANRVVVFDASWNP
CHDAQAVCRVYRYGQKKPCHIYRLVADYTLEKKIYDRQISKQGMSDRVVDDLNPMLNFTR
KEVENLLHFVEKEPAPQTSLDIKGIKESVLQLACLKYPHLITKEPFEHESLLLNRKDHKL
TKAEKKAAKKSYEEDKRTSVPYTRPSYAQYYPASDQSLTSIPAFSQRNWQPTLKGDEKPV
ASVRPVQSTPIPMMPRHVPLSGGVSSASSTNTSMNFPINYLQRAGVLVQKVVTTTDIVIP
GLNSSTDVQARINAGESIHIIRGTKGTYIRTSDGRIFAVRATGKPKAPEDGRMAASGSQG
PSLASTSNGRHSASSPKAPDPEGLARPVSPDSPEIISELQQYADVAAARESRQSSPSVSA
ALPGPPGQLMDNSTIPGTALGTEPCLGGHCLNSSLLVTGQPSGGRHPVLDLRGHKRKLAT
PSVTQESVRRRSRKGHLPAPVQPYEHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFM
GSNPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGMLP
SYSLPFSQPLLSEPRMFAPFPSPGLPSNLSRGVSVYPGYMSPHAGYPAGGLLRSQVPPFD
SHEVAEVGFSSNDDEDKDDDVIEVTGK
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgaatccgcctcagggagcgatccagacctggacccggacgtggagctggag
gatgaggaagaggaggaggaggaggaggaggaggtggcagtggaggagcatgacagggat
gacgaggaaggcctgctggatgacacatccctggaaggcatgtgtggcactgagcatgcc
cagctgggggaagatgggcagcggccgccgcggtgcacttcaactacctcatctcagtct
gagccttcagagcagcttaggcaccaaggcaagatcctagcatccgaggaccccaaaaag
aagcgagctcagaagccctctcacatgagaagaaacatacgaaagctactccgggaggat
cagttggagcccgtaaccaaagcagcacagcaggaagaattggaaagaagaaagcgcctg
gagcagcagaggaaagaatatgcagcccccattcctactgtccctttggagttcctacct
gaggaaattgtcttacgagctagtgatggtccccaactcccacctcgggtcttagcccag
gaagtcatttgtttggacagtagcagtggcagtgaggatgaaaagagtagtcgagacgag
gtaattgagctgagttctggagaggaggatacgctgcacatcgtggacagcagtgagtct
gtcagcgaggaggacgaggaagaggagaagggtggcacccatgtgaatgacgccttaaac
cagcatgatgctctcgggcgggtccttgtcaacctgaatcaccctccagaggaggagaat
gtcttcctggccccccagttggcacgggctgtgaaacctcatcagattggtgggatccgg
ttcctatatgataacctagtggagtccttagaaaggtttaagaccagtagtggctttggc
tgtatcctggcccatagcatgggcctggggaaaactctgcaagtgatctccttcattgat
gtccttttccgccatacgccagccaaaacagtccttgccattgtgccggtgaacactctt
cagaattggttggcagagttcaacatgtggctcccggctcctgaagccctcccagccgac
agcaagcctgaagaagtccagcctcggttctttaaagttcatatcttgaatgatgaacac
aagacggtggcatcccgtgctaaagtgacggctgattgggtttcagagggtggagtgcta
ctgatggggtatgagatgtacagactactcacactgaagaagtccttagccacaagtagg
ccgaagaaaaccaagaaacgctctcatcccgtcatcattgatctggatgaagaagaccgg
cagcaggagttccggagagagtttgagaaggccttatgccgccctggtcctgatgtggtg
atctgtgacgagggacaccgcatcaaaaattgccaagccagcacctcacaggctctgaag
aacatacgttctcgtcggcgggtagtgctgactggctaccctctacagaacaacctcatt
gagtactggtgcatggtggactttgtgcgcccagatttccttggtactcgtcaggagttt
agcaacatgtttgaacgccctatcctaaacggacagtgtattgacagcacacctcaggat
gtccgcctcatgcgctaccggagccatgttttgcacagcctcctggagggctttgtgcag
aggagaggccacactgtgttgaagattcacctccctgccaaagaagagaatgtgatcctg
gtgcggctttctcagatccagcgagatttgtacacacaattcatggaccgtttccgggat
tgtggtaccagtggctggttagggctgaatcctctgaaggctttctgtgtatgctgcaag
atctggaaccatcctgatgtgctgtatgaagcccttcagaaggaaaacctagccaatgag
caagacctagatgtggaagaacttggctcagcggggaccagtgcccgctgcccaccacat
ggcacaaaagtcaagggagaagatagtgccttgccttcctcaatgggagaagcaaccaac
agcaagttcctacagggagttggctttaaccctttccaggaacggggcaataacattgtt
acatatgagtgggccaaggagcttctgactaattatcagactggagtcctggagaactct
cccaagatggtactgcttttccacctgattgaagaaagcgtgaagctcggggacaagatt
cttgtatttagccagagcctttctaccttggctctcatcgaggagttcctagggaaacga
gacatgccttgtctgcctggtgccgaggggcaaggaacacagaagtgggttcgaaatgtc
agctacttccggctagatggtagcacccctgcctttgagagggagcggctcattaatcag
ttcaatgatcccagcaacctcaccacctggctgttccttctctccacaagggccggatgc
ttgggggtgaatctgattggtgccaatcgagtggtggtattcgatgcttcctggaaccct
tgccatgatgcccaggcagtatgtcgggtataccgttatggccagaaaaagccctgtcac
atctatcgactcgtggctgattatactcttgagaagaagatatatgaccggcagatttcc
aagcagggcatgtcagatcgggtagtggatgatctaaatccaatgctgaacttcacccgg
aaggaagtggaaaacctgctgcactttgttgagaaggagccagctccccaaacatctttg
gatataaaggggatcaaggagtcagtcttgcaacttgcctgcctgaagtaccctcacctc
atcaccaaggagccttttgagcacgagtcattgctcctcaaccgaaaagatcacaagctg
accaaagctgagaagaaagcagcaaagaaaagctatgaggaggacaaacgcacatcagta
ccctatacccgcccatcatatgcacagtattaccctgccagcgaccagagcctgaccagc
atccctgccttcagtcagaggaactggcagccaacactgaagggtgatgaaaagcctgtg
gccagcgttcgtcctgtacagtccacccccattcccatgatgccccggcatgtcccactc
agtggtggtgtaagctctgcctccagcacaaatacatccatgaacttccctatcaactac
ttgcagcgggcaggagtccttgtgcagaaagtggttaccacgacagatattgttatccct
ggactcaacagctccacagatgttcaggcaagaatcaatgctggtgagagcatccacatc
atccgagggacgaaagggacatacatccgcaccagtgatggacgcatctttgctgtccgg
gcgaccggcaaaccaaaggcccctgaagatggtcggatggctgcctcaggttcccagggg
ccttctcttgcgtccacaagcaatggcagacatagtgcctcatcacccaaagcccctgac
cccgaggggctggcccggccggtctctcctgacagcccagaaatcatcagtgaactccag
cagtatgcagatgtggccgctgctcgggaatcccggcagagctccccaagcgtcagtgct
gccctgcctgggcccccgggccagcttatggacaacagcaccattcctgggacagctctt
ggaactgagccatgccttgggggtcattgcctcaatagttccctcttggtgactggccag
cccagtggtggcaggcacccagtgctggacttaaggggccataagcgaaagttggctact
ccgtctgtcacccaggaatcagtccgtcgacggtccaggaagggccatctgccagccccc
gtgcagccctatgaacatgggtatccagtctctggcgggtttgcaatgccgcctgtctcc
ttaaatcataacctcaccacccccttcacctcccaggctggggagaattccctatttatg
ggcagtaatccctcctactaccagctgtccaatttgctggcagatgcccgcctggtgttt
ccagtgactactgaccctctggtgccagcaggccctgtcagttcctcttccacggctacc
tcagtcactgccagcaacccctccttcatgctcaacccctccgtgccagggatgctaccc
agctattcactcccattctcacagccactcctgtccgagcccaggatgtttgcgcctttc
ccttcccccggcttgcccagcaacctttctcggggcgtgtctgtctacccaggctatatg
tccccacatgcaggctacccagctggtggcctcctccggtcccaggtgcctccatttgac
tcgcatgaggtggcggaggtggggttcagctccaatgatgatgaggataaagatgatgat
gtgatagaggtcactgggaagtag

DBGET integrated database retrieval system