KEGG   Mus musculus (mouse): 81489
Entry
81489             CDS       T01002                                 

Gene name
Dnajb1, 0610007I11Rik, DjB1, HSPF1, Hdj1, Hsp, Hsp40
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B1
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81489 (Dnajb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    81489 (Dnajb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    81489 (Dnajb1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   81489 (Dnajb1)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 81489
NCBI-ProteinID: NP_061278
MGI: 1931874
Ensembl: ENSMUSG00000005483
Vega: OTTMUSG00000061608
UniProt: Q9QYJ3 Q3TU79
Position
8; 8 C2
AA seq 340 aa
MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLPI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggcaaggactactatcagacgctgggcctggcccgcggcgcgtccgacgacgagatc
aagcgagcctaccgccgccaggcgctgcgctaccacccggacaagaacaaggagcccggc
gctgaggagaagttcaaggagatcgccgaggcctacgacgtgctcagcgacccgcgcaag
cgcgagattttcgaccgctatggagaggaaggcctgaagggtggtagccccagtggagga
agcagtggtggtgctaatggtacctctttcagctacacattccacggagacccccatgcc
atgtttgctgagttcttcggtggcagaaacccctttgataccttttttgggcagcgcaac
ggggaagaaggcatggacattgatgacacattctctagctttccaatgggtatgggtggc
ttcaccaacatgaactttggacgttcccgcccttctcaagagcccacccggaagaagcaa
gatcctccagtcacccatgaccttcgggtctcccttgaagagatctacagcggctgtacc
aagaagatgaaaatctcccacaagcggctgaaccctgatggaaagagcattcgaaatgaa
gataagatcctgaccatcgaagtgaagaggggctggaaagaagggaccaaaatcaccttt
cccaaggaaggggaccagacctcgaacaacattccagcagacatcgtctttgttttaaag
gacaagccacacaatatcttcaagagagatggttctgatgtcatctatccagccaggatt
agccttcgggaggctctctgtggttgcactgtgaatgtccctactctggacggcaggacc
atccctgttgtattcaaagatgtcatcaggcctggtatgcggcggaaagtccctggagaa
ggcctccctctccccaaaacacctgagaaacgtggagaccttgttatcgagtttgaagtg
atcttcccggaaaggattcccgtctcatccagaaccatcctggagcaggttcttcccata
tag

DBGET integrated database retrieval system