KEGG   Mus musculus (house mouse): 81535
Entry
81535             CDS       T01002                                 
Symbol
Sgpp1, AI463453, SPP, SPP1, Spph1
Name
(RefSeq) sphingosine-1-phosphate phosphatase 1
  KO
K04716  sphingosine-1-phosphate phosphatase 1 [EC:3.1.3.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    81535 (Sgpp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    81535 (Sgpp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     81535 (Sgpp1)
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-GeneID: 81535
NCBI-ProteinID: NP_109675
MGI: 2135760
Ensembl: ENSMUSG00000021054
UniProt: Q9JI99 Q3UDY2
Position
12:complement(75761022..75782503)
AA seq 430 aa
MSLGQRLALLASRLQEPQRVASFQRLCGVEVPLSSPAADEDAETEVRGAPGEPRRRGRQP
GAEDSPAKADCCGAPNGVRNGLAAEPGPTGPRRAGSQRRNSLTGEEGELVKVSNLPLYYL
FCLGTELGNELFYILFFPFWIWNLDPFVGRRLVIIWVLVMYLGQCTKDIIRWPRPASPPV
IKLEVFYNSEYSMPSTHAMSGTAIPIAMFLLTYGRWQYPLIYGLILIPCWSSLVCLSRIY
MGMHSILDVIAGFLYTILILIIFYPLVDLIDNFNQTYKYAPLIIIGLHLILGIFSFTLDT
WSTSRGDTAEILGSGAGIACGSHAAYTLGLSLEPSLHMLPLAIPPLTVTLFGKAILRIVL
GMLLVLFVRDIMKKITIPLACKLSSIPCHDIRQARQHMEVELPYRYITYGMVGFSITFLV
PYVFSFIGIS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtccctggggcagcggctggctctgctggccagccgtctgcaggagccgcagcgggtg
gcgagcttccagcgtctgtgtggggtggaggtgccgctcagcagcccggcggcggacgag
gatgcagagaccgaggttcgcggagccccgggagaaccccggcgacggggacggcagccg
ggcgctgaggacagccccgccaaggcggactgctgcggtgccccgaacggcgtgcgcaac
gggctggcggccgagccgggcccgaccgggccccgccgcgcgggctcgcagcgccgcaac
tcgttgacgggcgaggagggcgagctggtcaaagtgagcaacttgccgctctactacctg
ttctgcttaggcacggaactgggcaacgagctcttctacatcttattcttccccttctgg
atctggaatctcgacccctttgtgggccggaggctggtgatcatctgggtgctggtcatg
tacctgggccagtgcaccaaggacatcatccgctggccacggccggcctcgccgcctgtc
atcaagctggaggtcttctacaactcggaatacagcatgccctccacgcatgccatgtca
ggcaccgccatccccatcgccatgttcctgctcacctatggccgctggcagtatcctctt
atctacgggctgattctcattccctgctggagttcactagtttgcctaagtagaatctac
atgggaatgcattctatcctggatgtcattgctggattcttgtataccattttaatctta
attatcttctacccattggtggacctgattgacaacttcaaccaaacttacaaatatgcg
ccgctcatcatcatcgggcttcacttaattttgggcatcttctctttcacccttgacacc
tggagcacatcccgaggagacacggctgagattctgggaagtggtgctgggattgcatgt
ggctcacacgctgcttataccctgggcctatccttagaaccttctctgcacatgttaccc
ttagctatcccccctcttactgtaactctgtttggaaaagccatattacggatcgtccta
ggaatgctgcttgtactgttcgtgagggatatcatgaagaagatcaccattcctctagcc
tgtaaactctccagtattccgtgtcatgacattcgccaagcaaggcagcacatggaagtg
gagctgccataccggtatattacctacgggatggttgggttctccatcacgtttttggtc
ccctatgtattttcctttattggtatctcttga

DBGET integrated database retrieval system