KEGG   Mus musculus (mouse): 81630
Entry
81630             CDS       T01002                                 

Gene name
Zbtb22, 1110008J20Rik, AI265210, AI415166, Bin, Bing1, Zfp29, Zfp297
Definition
(RefSeq) zinc finger and BTB domain containing 22
  KO
K10502  zinc finger and BTB domain-containing protein 22
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    81630 (Zbtb22)
   04121 Ubiquitin system [BR:mmu04121]
    81630 (Zbtb22)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    81630 (Zbtb22)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     81630 (Zbtb22)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_jaz zf-Di19 zf-C2H2_4 DUF5810 Elf1 Rtf2 zf-C2H2_6
Other DBs
NCBI-GeneID: 81630
NCBI-ProteinID: NP_065650
MGI: 1931870
Ensembl: ENSMUSG00000051390
Vega: OTTMUSG00000037069
UniProt: Q9Z0G7 Q3TXW4
Position
17; 17 B1
AA seq 638 aa
MEPSALSPSGATLPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVS
IRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMA
AADIVNFLTVGSVLQMWHIVDKCTELLREGRSAATTTTVTTAAAPSVSVPCASVPSGNGG
TVAPATVGSVRSHTSSRASENQSPSSSNYFSPRESTDFSSTSQDAFVASAAGSGNRRDGG
PVFPAPVVGSAGTTSGKLLLEADELCDDGGDGRGAVAPGAGLRRSNCMPASAVPQKHWVY
VKQARNCPAPASLVHQDPDLEDEEEEEDLVLTCEDDEDEEMGGGSGVPAGGEPEATLSIS
DVRTLTEPADKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGGPTPSSYALTHPPRPLLPL
DVPGNQILVFPSSSSQAPGQPPGNTAEHGAVTLGGTSAVGLGIPSGSGGAPGGTGNSDGN
KIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYEC
SVCAKKFMWRDSFMRHRGHCERRHRMGVGGVGSGPGPGPGPGTPSGPALQPKRESSTVGG
GSGDEANSATPPSHRRVWSPPSVHKVEMDFSGGGGAAH
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggagccgtctgctctgtcacccagtggggccacactcccactgcctctgtcactggct
ccaccgccactgcctctgccggcagctgcagtggtacacgtgtccttccctgaggtgacc
agtgccctcctggaatccctcaaccagcagcggctccagggtcagctctgtgatgtgtcc
atccgcgtgcagggacgggagttccgcgctcacagggccgtcttggctgcctcctctcct
tacttccacgaccaggtcctactgaaaggcatgacttccatttccctgccaagcgtcatg
gacccaggcgcttttgagactgtcctggcctcagcttacacgggccgcctcagcatggct
gctgcggacattgtcaacttcctcacagtggggtcggtcctccagatgtggcacattgtg
gataagtgcactgaactccttcgggagggtcgatccgcagccactacaaccactgtcact
actgctgcagccccctctgtctctgtcccttgtgccagtgtcccatcagggaatgggggc
actgtcgcccctgccaccgtaggctctgtccgttcccatacctccagcagggccagtgag
aatcagtctcccagcagtagcaactacttcagcccccgggagtcgactgatttctcctct
acctcccaggatgcatttgtggcctcagcagcaggtagtgggaaccgtcgggatggtggc
ccggtgttcccagcccctgtggttggcagtgcgggtaccacctccgggaagttgctgctg
gaggccgatgagctatgcgatgacggtggggatgggagaggggccgtggcccccggggct
gggctccggaggtctaactgcatgcctgccagtgcagtgccacagaaacactgggtgtat
gtgaagcaagctagaaattgccctgcaccagcctccctggtccaccaagaccccgatcta
gaagatgaggaagaggaggaagatctggtgttgacttgtgaggatgatgaggatgaagaa
atgggaggcggctctggggttcctgcagggggagagcccgaggctaccctcagtatcagt
gatgttcggaccttgaccgagcctgcagacaagggggaagagcaggtcaacttctgtgaa
tcctccaatgactttggcccctatgagggtgggggcgctggggcagggcttgatgacccc
ggaggacccaccccttcctcctatgccctcacccaccctccacgacccctccttccattg
gatgtgccgggcaaccagatcttggttttcccatcctcctcttcacaggctccaggccag
ccaccagggaacacagctgagcacggggcagtgaccctcgggggcacctctgcggtgggg
ctgggcataccaagtggctctggtggggctcctggagggacaggcaacagcgacgggaat
aagatctttctgtgccactgtgggaaggctttctcacataagagcatgcgggaccggcac
gtgaatatgcatctcaacctgcgaccctttgactgccccgtgtgcaacaaaaagttcaag
atgaaacaccacctgaccgagcacatgaagacacacacgggcctcaagccgtacgaatgc
agtgtctgcgccaagaagttcatgtggcgggacagtttcatgcgtcaccggggacactgt
gagcgtcggcaccggatgggtgtgggtggggtcggatctggaccgggtcctggacctgga
cccgggacaccttctgggccagcattgcaacccaagagggagtcttccacagtgggtggg
ggcagtggcgatgaggcaaattcggccacgcccccgtcccataggcgtgtctggtcccca
cccagcgtgcacaaagtggagatggatttcagtgggggtggaggtgcagcacactga

DBGET integrated database retrieval system