KEGG   Mus musculus (mouse): 81701
Entry
81701             CDS       T01002                                 

Symbol
Egfl8, Ng3
Name
(RefSeq) EGF-like domain 8
  KO
K24465  epidermal growth factor-like protein 7/8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    81701 (Egfl8)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   81701 (Egfl8)
SSDB
Motif
Pfam: EMI EGF_CA EGF FXa_inhibition hEGF EGF_2
Other DBs
NCBI-GeneID: 81701
NCBI-ProteinID: NP_690886
MGI: 1932094
Ensembl: ENSMUSG00000015467
Vega: OTTMUSG00000035858
UniProt: Q6GUQ1 B9EJ41
Position
17 B1; 17 18.19 cM
AA seq 293 aa
MGLWAELCISLRGLSFFLVLMTGEGTRGGSFKESLGVCSKQTLLVPLRYNESYSQPVYKP
YLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLN
GGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDG
RTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAV
LPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
NT seq 882 nt   +upstreamnt  +downstreamnt
atggggctctgggctgagctgtgcatttccctacgaggactctcattcttcctggtgctg
atgacgggcgaagggaccagaggaggatctttcaaagagagtttgggagtgtgctccaag
cagacgctgctggttcctctccgttacaacgagtcctatagtcaaccggtgtacaaaccc
tacctgaccttgtgtgcggggaggcgcatatgtagcacctacaggaccacataccgtgtg
gcctggcgggaggtgaggcgggaggtaccacagacacacgtggtgtgctgtcagggctgg
aagaagccacacccaggagctctcacctgtgatgccatctgctccaagccttgtcttaat
ggaggtgtctgcactggaccagaccggtgcgagtgtgccccaggctggggaggaaagcat
tgccacgtggatgtcgatgaatgcagggccagccttaccctctgctctcatggctgcctc
aacacactgggcagcttcttgtgcagctgtccacaccccctggtgctgggtctcgatgga
cgcacctgtgcaggggggcctccagagtccccgacaagtgccagcatcctcagtgtggca
gttcgggaagcagacagcgaagaggagcgagccctgaggtgggaggttgcagagcttcgt
gggcgtctggagaagctggagcagtgggccacacaggctggggcctgggttcgagcagtg
ctgcccatgccccctgaagagctgcggcctgaacaggtggctgagctttggggccggggt
gacagaattgagtccctcagcgaccaggtgctgctactggaggaaagactgggtgcctgt
gcctgtgaggataacagcctgggcccaagcctgcgtggatga

DBGET integrated database retrieval system