KEGG   Mus musculus (mouse): 81702
Entry
81702             CDS       T01002                                 

Gene name
Ankrd17, 4933425K22Rik, A130069E23Rik, A930008M01, AA407558, AA516750, AU040470, Foe, Gt, Gtar, Mask, mKIAA0697
Definition
(RefSeq) ankyrin repeat domain 17
  KO
K16726  ankyrin repeat domain-containing protein 17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    81702 (Ankrd17)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     81702 (Ankrd17)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 KH_1 KH_4
Other DBs
NCBI-GeneID: 81702
NCBI-ProteinID: NP_112148
MGI: 1932101
Ensembl: ENSMUSG00000055204
Vega: OTTMUSG00000055446
UniProt: Q99NH0
Position
5; 5 E1
AA seq 2603 aa
MEKATVPAAAEGEGSPPAAAAVAAPPAAAAAEVGGGARPASSPRGMVRVCDLLLKKKPPQ
QQQQQQPPHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGTSSNNSEEEEDDDD
EEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLEAAGI
GKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAEACSE
GDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITP
LMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHN
ENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAG
ADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAA
LLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCG
GFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYA
CENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANND
HTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLL
AAPPPDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANLAATLPVRSKAASKQKS
NSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHADQLT
KEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQQQQQ
SCQHLGLFTSVGVGEQLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQALPL
ATGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLNDTLD
DIMAAVSGRASAMSNTPTHSIAASVSQPQTPTPSPIISPSAMLPIYPAIDIDAQTESNHD
TALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEA
QSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLN
AGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGR
TEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTAL
TIAADKGHYKFCELLIGKGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQATADVDAADN
RKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQA
KDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLEEIEA
KNKENFELQAAQEKEKLKVEEEPEVLTEPPSATTTTTIGISATWTTLAGSHGKRNNTITT
TSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRISSCSD
ESSNSNSSRKSNNHASAVVTTTMASKKQPSVLVTFPKEERKSVSGKASIKLSETVNEGTS
NSLSTCTKSGPSPLSSPNGKLTVASPKRGPKREEGWKEVVRRSKKVSVPSTVISRVIGRG
GCNINAIRECTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPDKEIDELI
PKNRLKSSTANSKIGSSAPTTTAANSSLMGIKMTTVALSSTSQTATALTVPAISSASTHK
TIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPAQSTW
GPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTASSSASAVPGTT
SNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNSTAPTNATYPMPTAKEHYPVSSPS
SPSPPAQPGGVSRNSPLDCGSASPNKGASASEQEASSPPVVEPANSRPPHSSSSSGSSSG
HSTQQQPPGSVPQEPRPPLQQSQVPSPDVRMTVPPTATSSAPVAVPSTAPVTYPMPQTQM
GCSQPPKMEAPAIRPPSHATAAPHKTPAPVQSSSASVLNVNHIKRPHSVPSSVQLPSTLS
TQSACQNSVHPANKPVAPNFSAPLPFGPFSTLFENNPTNAHAFWGGPVVSSQSTPESMLS
GKSSYLPNSDPLHQSDTSKAPGFRPPLQRPAPSPSGIVNMDTPYGSVTPSSTHLGNFASS
LSGGQMYGPGAPLGGAPLGGAPTAANFNRQHFSPLSLLTPCSSASNESPAQSVSSGVRAP
SPAPSSVPLGSEKPSSVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIW
SFEGIGGNQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQHVPA
GYMDFPKVGSMPFSVYGNAMLPPVAPIADGAGGPIFNGPHSAEPSWNSLIKMVSSSTENN
GPQTVWTGPWAPHMNSVHMNQLG
NT seq 7812 nt   +upstreamnt  +downstreamnt
atggagaaggcgacggttccggcggcggctgagggagaagggagtcccccggcggcggcg
gcagtggcggccccccccgcggcggcggcggcggaggtcggcggcggggctcgcccggcc
tcttctcctcgtgggatggtgcgagtctgcgacctgctcctgaagaagaagccaccgcag
caacagcagcagcagcagccgccgcaccacaaggccaagcggaaccggacttgccgaccc
ccgagcagcagcgaaagcagcagcgacagcgacaacagcggcggcggtggcggtggagga
ggaggaggaggcggcggcaccagcagcaacaacagcgaggaagaggaggacgacgacgac
gaggaagaggaggtttctgaggtggagtctttcattttggaccaggatgatttggagaat
ccaatgctggaaacagcttccaagttgcttctatcaggcactgctgacggtgctgacctc
aggacagtagatccagagacgcaggctcgactggaagctttactagaagctgcaggaata
ggcaagttatcgacggcggatggtaaagcctttgcagaccctgaagtgctccgcaggtta
acatcgtctgtcagttgtgcgttggatgaagctgctgctgcacttacccggatgagagct
gagagcacagcaaatgcagggcagtcggacaaccgcagtctggcagaagcgtgttcagaa
ggagatgtaaatgctgtgcggaaactactcattgaaggtcggagtgtgaatgagcacacc
gaggaaggggagagcctcctttgtctcgcttgttctgctgggtactatgagcttgcacag
gttttattggcaatgcacgcaaatgtggaagacaggggaatcaaaggtgacatcacacct
ttaatggctgctgctaatggaggacatgtcaaaatcgtgaagttgctgctagctcataaa
gctgatgtcaatgcacagtcttcaacaggcaacacagctctcacctatgcttgtgctgga
ggctacgtagatgttgtaaaggtgctcttggaatccggtgctagtattgaggaccataat
gagaatggtcacacacctcttatggaagctggaagtgctgggcatgtggaagtagccaga
ttgctgctagaaaatggagctggcatcaatacgcattccaatgaatttaaagagagtgcc
cttacattagcttgttataaaggacatctagagatggtgcgatttcttttggaagcaggc
gctgatcaagaacataagacagatgaaatgcacactgctctaatggaggcttgcatggat
ggccatgttgaagtagctaggttgcttctggacagtggtgctcaagtgaacatgccagct
gattcatttgagtcaccattgactttggctgcatgtggaggacatgtggaacttgcagcc
ttacttattgaaagaggagctagcctggaagaggtcaatgatgaaggttatactcctttg
atggaggcagctcgtgaaggacatgaagaaatggtggcgttacttcttggccaaggagca
aatatcaatgcacagacagaagaaactcaagaaactgccttgaccctggcttgctgtgga
ggctttctggaagtagcagactttctgattaaggctggggctgatatagaactagggtgt
tctactcctttgatggaagctgctcaagaaggtcacttggagttagtgaaatacttacta
gctgcaggagctaatgttcatgcaacgacagcaacaggagacacagctttaacatatgcc
tgtgaaaatggccatacggatgtagcagacgtcttactccaggcaggtgcagatctggaa
catgagtcagaaggtggaagaactcctttaatgaaagctgcaagagcgggtcatgtttgc
acagtccagttcttaattagcaaaggagcaaatgtgaatcgaaccacagctaataatgat
catactgtactgtccctggcttgtgcaggaggtcatttggcagtggtagaactacttttg
gctcatggagcagaccctactcaccgtttaaaagatggctcaaccatgttgatagaagca
gcaaagggtggccatacgagtgttgtttgctatcttttagactatcccaataatctactt
gcagcccctccaccagatgtcactcagctaactcccccatcccatgatttaaatagggca
cctcgagtaccagttcaagcactgcccatggttgtcccacctcaggagcctgacaaacca
cctgccaaccttgctgctactcttcccgttaggagtaaagctgcttctaaacaaaagtcc
aacagccatttgccagcaaacagccaggatgtacagggttacatcaccaatcagtctcca
gagagcattgtagaagaggctcagggaaagttaacagaactggaacagaggataaaagaa
gccatagaaaaaaatgcacagctgcagtccttggagctggctcatgctgaccaactcacc
aaggagaagatcgaggagctgaacaaaacgagggaggaacaaattcagaagaagcaaaag
attctggaggagctgcagaaagtagagcgagagctacaactgaaaactcagcagcagctt
aaaaaacagtatctagaagttaaagctcaacgaattcagcttcagcagcagcagcaacag
tcttgccagcatctgggactatttacttctgttggggttggagagcagctttccgaggga
gactatgcacggttacagcaagtggatcctgttttgcttaaagatgaaccccagcagact
gctgctcagatgggttttgcaccaatccagcctctggcgatgcctcaagctttgcctctg
gcaacgggtcccttgcctccagggtccatcgcaaatcttacagaacttcaaggagtgata
gttggacagccagtactgggccaagcacagttggcagggctggggcaaggaattctcact
gaaacacaacaagggttaatggtagccagccctgctcagaccctcaatgacacgctggat
gacatcatggcagcagtcagtggaagagcatctgcaatgtcaaacactcctacccacagt
atcgctgcttctgtttcccaacctcagactccaactccaagtcccatcatctctccttca
gccatgctacctatctaccctgccattgatattgatgcacagactgagagtaatcatgat
actgcactaacacttgcctgtgctggtggccatgaggaactggtacaaacactactagag
agaggagctagtattgaacatcgagacaagaaaggttttactccactcatcttggctgct
acagctggtcatgttggtgttgtagagatattgctggacaatggtgcagacattgaagcc
cagtcagaaagaaccaaggacacaccactgtccttggcttgttctgggggcaggcaggag
gtggtggagttgttgttagctcgcggtgcaaataaagaacacaggaatgtttctgattat
acacctctaagcctggctgcttctggtggctatgtgaacatcatcaaaatactgctaaat
gcaggagctgagatcaattcaagaactggcagcaaattgggcatttctccactgatgttg
gcagctatgaatgggcatacagctgcagttaagctccttttagacatgggctctgacata
aatgctcagatagaaaccaatcggaacactgcccttacattagcctgcttccaaggaaga
actgaagtggttagccttctgcttgatcgaaaagcaaatgttgaacatagggctaagact
ggcctcacaccattaatggaagcagcgtctggtggttatgcagaggtgggccgagttctt
ttggataaaggtgctgatgtgaatgcccctccagtgccctcctccagagacacagcttta
accatagccgcagataaagggcattataaattttgtgaacttcttattggcaagggagct
catattgatgtgcgaaacaagaaggggaacactccgttatggctagcagcaaatggtgga
cacctagatgtggttcagctactggtgcaagcaactgcagatgtagatgcagcagataac
cgcaagataactccgctcatggctgcatttagaaagggtcatgtgaaggtggtgcgctac
ttagtcaaagaggtcaatcagtttccatcagattcggaatgcatgaggtatatagcaacc
atcactgataaggagatgctgaagaagtgtcatctttgtatggagtcaatagtacaagcc
aaagacaggcaggctgctgaagcaaataagaatgccagcatactactggaggagctagac
ctggaaaagttaagggaagaaagtcgaaggctggctttggctgctaaaagagaaaagcga
aaagagaaaagaaggaaaaaaaaggaagaacaaagaaggaaattagaggaaattgaagcc
aaaaataaggagaactttgaacttcaagctgctcaagaaaaagagaaacttaaagttgaa
gaagaacctgaagtcttgacagagcctccaagtgccactaccaccactaccataggaata
tctgctacatggactactttggcaggttcccatggtaaaagaaataataccataactaca
accagctcaaagaggaaaaacaggaaaaataaaattactccagaaaatgttcaaattata
tttgatgatccactaccaatctcgtacagtcagccagagaaggtgaatggagagtccaag
agcagcagcaccagcgagagtggggacagtgacaacatgaggatttccagctgcagtgac
gagagcagcaacagcaacagcagcagaaagagtaacaatcatgcgtcggctgtggtcacg
accactatggccagcaagaagcagccgtctgttcttgttacatttccaaaagaggagaga
aaatccgtttcgggcaaggcttctataaaattgtcagagactgtcaatgaagggaccagt
aattctctgtcaacttgtacaaaatctggtccgtctcctctttcctctccaaatgggaag
ttaacagtagcaagtcctaagcgtgggccaaagagggaagaaggatggaaggaggtcgta
aggcggtcaaaaaaagtatctgttccatcaactgtgatatccagagttattggaagaggt
ggctgtaatatcaatgctattcgggaatgtactggtgcacacatagatattgacaagcaa
aaagacaagactggagaccggataataactataaggggtggcactgaatcaacaagacaa
gcaactcagttgatcaatgctttgatcaaggatccagacaaagaaattgatgaacttatt
ccaaagaatcgtttgaaaagctccacagcaaattccaaaatcgggtcctcagcacctacc
accactgctgctaacagttccttaatggggatcaaaatgacaactgtagctctgtcgtcg
acatctcagactgccactgcactcaccgttcctgccatctcttctgcatccactcacaaa
accattaagaaccctgtgaataatgtgaggcctgggtttccagtttctcttccattagca
tatcctcctccacagtttgcacacgctttgcttgctgctcagactttccagcagatccgt
ccaccacggttgcccatgacccactttggaggtactttcccaccagctcagtccacttgg
ggtccttttcctgtcaggcctttgagccctgccagagctactaactcgcctaagcctcac
atggtgcctcgccatagcaatcagaatagcagtggttctcaggtgaattcagcaggttct
ctaacttcaagtccaacaactacagccagttcatcagcttcagcggtgcctggtacaact
tcaaatggcagtccaagttctccttcagtcagaaggcagctttttgtcacagttgtgaag
acatccaatgccacaaccacaacagtcacaactacagcaagcaacaacagcaccgcaccc
acaaacgccacatatcctatgcctactgccaaagaacactatccagtatcatccccatct
tccccatcaccaccagcccagccaggaggggtttctagaaacagccctttggattgtgga
tcagcatccccaaataaaggggcatctgcttccgaacaggaagcaagcagtccaccagta
gtagaacctgcaaatagcagacccccacacagcagcagttcttctgggagctcatcaggt
cattccactcagcagcagcctccgggatctgttcctcaggagccaagaccccctcttcag
cagtctcaggttccttccccggatgtgagaatgactgttcctcctacagcaacaagttct
gctccagtggcggtgccttctactgcgcctgtgacgtaccctatgcctcagacacaaatg
ggatgctcccagcctcctaaaatggaagcccctgctattagaccaccctctcatgccaca
gctgcccctcacaagactccagctccagtgcagagttcatctgcttcagtcctcaatgtc
aatcacattaaaagacctcatagtgtcccctcctctgtccagctaccttcgaccttaagt
acacaaagtgcttgtcagaattcagtacatccagcaaataagcctgttgctcccaacttc
agtgccccattaccatttgggccctttagcacattgtttgaaaacaaccctactaatgct
catgccttctggggaggacctgttgtttcatctcagtcaacaccagaatctatgctgtca
ggaaaatcctcgtatttgccaaattcagatcctttacatcagtcagatacttccaaagca
ccaggttttaggccaccattacagagacctgctccaagtccctcaggtattgtcaacatg
gacacaccatatggttctgtaacaccttcttctacacatttgggaaactttgcctcaagt
ctttcaggaggtcagatgtatgggcctggagcacctcttggaggagcaccccttggagga
gcacctactgctgctaactttaacagacagcatttttccccacttagtttgttgactcca
tgttcatcagcatcaaatgagtctccagcacagtctgtatcctctggagttcgtgcaccg
tctcctgccccatcctcagtacctttagggtctgaaaagcccagcagtgtctctcaggac
aggaaagtaccagtcccaattgggactgagcgttctgcacggatcaggcaaactggaact
tcagctccatctgttattgggagtaatttgtctacatcagtaggacatagtggcatctgg
tcctttgaagggattggtggcaatcaagacaaagtggactggtgtaaccctgggatggga
aatcccatgattcacaggccaatgtctgacccaggagtgttttcacagcatcaagcaatg
gagcgagatagtacagggattgtaaccccttctggtacattccatcagcatgttcctgca
ggatacatggactttcctaaagttgggagtatgcctttttctgtatatgggaatgcaatg
cttcctccagtagcacctatcgctgatggtgctggaggacccatatttaatggccctcat
tctgcagaaccttcttggaactcactgataaagatggtttcaagttccacagaaaacaat
ggtcctcaaacggtatggactggaccctgggcacctcacatgaacagtgtgcacatgaac
cagcttggctga

DBGET integrated database retrieval system