KEGG   Mus musculus (mouse): 81845
Entry
81845             CDS       T01002                                 

Gene name
Gpank1, Bat-4, Bat4, D17H6S54E, G5
Definition
(RefSeq) G patch domain and ankyrin repeats 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: G-patch Ank_2 Ank_4 Ank_3 Ank_5 SPT6_acidic G-patch_2
Other DBs
NCBI-GeneID: 81845
NCBI-ProteinID: NP_115849
MGI: 2148975
Ensembl: ENSMUSG00000092417
Vega: OTTMUSG00000037177
UniProt: Q61858
Position
17 B1; 17 18.59 cM
AA seq 372 aa
MVGSLACHILALPSLHFLVSLTGMSRPSFIEFTPAADSSDLWKDGQQQPQQEKAEPVLDG
AAARAFYEALIADDSSSSKPQRAEPMRERKKKRRRVTREPAAAGVPRQGRALEDEDRMAQ
WILLAAQNGDLTELRRLLEPQEAGGAGGNINARDAFWWTPLMCAARAGQGAAVRYLLGRG
AAWVGVCDLGGRDAAQLAEEAGFPEVARMVRESHGETRSPENQNRSTPSSSQFCEDCGAH
FEDSNHHTSTAHLLSLSRRPQPSNLPLGVPTSSPGFRLLLRGGWEPGMGLGPRGEGRANP
IPTILKRDQEGLGYRSPPQPRVTHFAARDTRAVSGRERVPRVATLSQRENRRQEEKGRAW
ERDLRLYMNLEF
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggttggatcgcttgcttgtcacatccttgccttgcccagtcttcattttcttgtttct
ctcacaggcatgtctaggccatccttcatcgaatttaccccagcggctgactccagtgac
ctctggaaggatgggcagcagcaaccacagcaggagaaagcagagcctgtcctggacggg
gctgctgcccgggctttctatgaggctctaatcgcagatgacagtagttcctctaagccc
cagagagctgaacctatgagggagaggaagaagaagagaagaagagtgactagggagcct
gcagcagcaggagtccccagacaaggaagagcacttgaggatgaagacaggatggcccag
tggatcctgctggcagcccagaatggggatctgacagaactccggaggctgctagaaccc
caagaggcagggggagctggagggaatatcaatgctcgtgatgccttctggtggactccc
ttgatgtgtgctgcccgagcaggccagggcgccgctgtgcgctatctcctgggccgagga
gctgcctgggttggagtctgtgacctgggaggcagagatgctgcccagctggctgaagaa
gcaggcttccctgaggtagcccgtatggtcagagagagtcatggagagacaaggagccct
gagaaccagaaccgatctaccccctcctcgtcccagttctgtgaggactgtggtgcccac
tttgaagactccaaccaccacacatctactgctcacctgctgtcactgtccaggagaccc
cagccctccaaccttccccttggggtgcccacttccagtcctggcttcaggctactgctg
agaggtggctgggaaccaggaatggggctaggaccccggggtgaaggccgtgccaaccct
atccccactatcctcaagagggaccaggaaggattgggttatagatccccaccccaaccc
cgagtcacacactttgcagcgcgggatacccgggctgtgtctgggagagagagagtccct
cgagttgccacactgagtcagagggagaacagaaggcaagaagaaaagggcagagcctgg
gagcgagatctaagactgtacatgaacctcgagttctga

DBGET integrated database retrieval system