KEGG   Mus musculus (mouse): 81896
Entry
81896             CDS       T01002                                 

Gene name
Ift122, C86139, Wdr1, Wdr10, s, sopb
Definition
(RefSeq) intraflagellar transport 122
  KO
K19656  intraflagellar transport protein 122
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    81896 (Ift122)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex A
    81896 (Ift122)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Coatomer_WDAD eIF2A PHTB1_N TPR_7
Other DBs
NCBI-GeneID: 81896
NCBI-ProteinID: NP_001161235
MGI: 1932386
Ensembl: ENSMUSG00000030323
Vega: OTTMUSG00000023171
UniProt: Q6NWV3
Position
6; 6 E3
AA seq 1182 aa
MRAVLTWRDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVA
YAKDGKRFASGSADKSIIIWTSKLEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWS
PEQKSVSKHKSSSKITCCSWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSLSPIW
SICWNPSREEHNDILAVADWGQKLSFYQLSGKQIGKDRPLNFDPCCISYFTKGEYILVGG
SDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKPDSNYVVVGCQDGTISFYQLIFSTVHGLY
KDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDS
TDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVI
GGPAGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCL
VYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNG
SKIFCLHVFSMSAVEVPQSAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGLEF
ETARKAFTRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHE
NLALDMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAK
AIEISGSHGWVDMLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQ
LYVDTKRWDEAFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQGEAVRVLE
QLTHNAVVESRFNDAAYYYWMLSMQCLDMAQDPAQKDAMLDKFHHFQHLAELYHGYQTIH
RYTEEPFSFDLPETLFNISKFLLHSLTKATPLGISKVNTLFTLAKQSKALGAYKLARHAY
DKLRGLQIPARIQKSIELGTLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQ
PFIFSASSYEVLHLVEFYLEEGITDEEAVALIDLEAPRHKREGKWRETSSNNSQTLKLDE
TMDSIGEDDPFTAKLSFEQGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLL
PDASITMCPSCFQMFHSEDYELLVLQHACCPYCRRRIDDTGP
NT seq 3549 nt   +upstreamnt  +downstreamnt
atgagggccgtgttgacgtggagagacaaagcggagcagtgtatctacgacctcgcattt
aagcctgatggaacacaactgattctggctgcaggaaacagattgctggtttatgacacc
tctgatggcaccttacttcagcccctgaagggacacaaagacaccgtgtactgtgtggcg
tatgcaaaggatggcaagcgctttgcatctggatctgctgacaagagcatcattatctgg
acctcaaaacttgaaggcattctgaagtacacgcacaacgactctatacagtgtgtctcc
tacaatcctgttacccaccagctggcatcttgttcctccagtgactttgggttatggtct
cctgagcagaagtctgtgtccaagcacaaatccagcagcaagatcacgtgctgcagctgg
acaaacgatggtcagtacctggctctgggcatggccaatggcatcatcagtatacggaac
aagaatggtgaagagaaagtgaagatcgagcgccctgggggctccctctccccaatatgg
tccatctgctggaacccttcaagagaggaacataatgacatcctggctgtagctgactgg
ggacagaaactttccttctaccagctgagtggaaaacagattgggaaggatcggccactg
aactttgacccctgttgcatcagctacttcactaaaggagagtacattttggtgggaggt
tcagacaagcaggtatctcttttcaccaaggatggagtgcgactggggaccgttggggag
cagaactcctgggtgtggacctgtagagtgaaacctgactccaattatgtggtggtcggc
tgccaggatggcaccatctccttctaccagctcatcttcagcacagtccatgggctctac
aaagatcggtatgcctacagggacagcatgacagacgtcatcgtgcagcacctcatcaca
gagcagaaagttaggattaagtgcagagagcttgtcaagaaaattgccatctacaaaaat
cgattagctatccagctgccagagaagatcctcatctacgagctgtactctgaagactcg
acagacatgcactaccgggtaaaggagaaaattgtcaagaagtttgagtgcaacctgctg
gtggtgtgtgctgaccacatcatcctgtgccaggagaaacggctacagtgcctgtccttc
agtggagtgaaggaaagggaatggcagatggaatctctcatccgctacatcaaggtgatc
ggtggccctgctggaagagaaggtctgttggtaggcctgaaaaacggccagatcctgaag
atctttgtggacaatctttttgctattgtcctgctgaagcaggccacagccgtgcgctgc
ctggacatgagtgcctcccggaacaagctggctgtggtggatgagaatgacacgtgcctg
gtgtacgacatccacacgaaggaactgcttttccaggaaccgaatgctaacagcgtggcc
tggaacacgcagtgtgaggacatgctctgcttctctggaggaggctacctcaacatcaag
gccagcaccttcccagtgcaccagcagaagctgcagggctttgtggttggctacaacggc
tccaagatcttctgccttcatgtcttctctatgtctgccgtggaggtgccacagtccgct
ccaatgtaccagtacctcgataggaagatgttcaaagaagcatatcagatcgcttgcttg
ggagtgacagacgctgattggcgtgaactggccatggaagctctagaaggactagagttt
gagacggcaaggaaggccttcaccagagtccaggaccttcgatacctagaactgatcagc
agtattgaggagaggaagaagaggggagagaccaacaatgacctgtttctggcagatgtg
ttttcctaccaggggaagtttcatgaagccgccaaactatacaagaggagcgggcatgag
aacctcgctctcgacatgtatactgacctctgcatgtttgagtacgccaaggatttcctt
ggatctggagaccctaaagaaacgaagatgctcatcaccaagcaggccgactgggccaga
aacatcaatgagcccaaagctgcagtggagatgtacatctcagcaggggagcacgccaag
gccatagagatcagcggcagccatggctgggtggacatgttgatagacattgctcggaag
ctggacaaggctgaacgggagcccctgctcatgtgtgcttgctactttaagaagctggac
agtcctggctatgctgctgagacctacctgaagatcggggacctgaagtctctggtgcag
ctgtatgtggacaccaagcgctgggatgaggcctttgcgttaggtgagaagcacccggag
ttcaaggatgacgtctacgtgccctacgcgcagtggctggcggagaacgaccgctttgag
gaagcccagaaagccttccacaaggccgggaggcagggagaagcagtccgggtgctggag
cagctcacgcacaatgctgtggtggagagcaggtttaacgacgctgcctattattactgg
atgctgtccatgcagtgcctcgacatggctcaagatcctgcccagaaggacgcgatgctg
gacaagtttcaccacttccaacacctggctgagctgtaccatggctatcaaaccattcac
cgatacacggaggagccattcagctttgacctccctgaaaccctcttcaacatctccaag
ttcttgctgcacagcctgaccaaggccacccccttgggtatctccaaagtgaatacactc
ttcacactggctaagcagagcaaggctctgggtgcttacaagctggcccggcatgcctat
gacaagctacgggggctgcagatccccgccaggatccagaagtccattgagctgggcacc
ctgaccatccgctccaagcccttccatgacagtgaggagctggtacccttgtgctaccgc
tgttctaccaacaacccgctgctgaacaaccttggcaacgtctgcatcaactgccgccag
cccttcatcttctccgcctcttcctatgaggtgctgcacctggtggaattctacctggaa
gaggggatcactgacgaagaagctgttgccctcatcgatctggaggcaccaagacacaag
agggagggcaagtggcgagagacctcaagcaacaattcccagacgttgaagctggacgag
accatggactccataggagaagatgacccatttacagccaagctgagctttgagcaaggt
agctctgagtttgtgcctgtggtggtgaaccggtcagtactacgctccatgagccgaaga
gatgttctcatcaagcgctggcccccgccgctgcaatggcaatatttccgctcgctgttg
cctgatgcctccatcaccatgtgcccctcctgctttcagatgttccattcagaggactac
gaactgcttgtgctccagcacgcctgctgcccttactgccgaaggcgtatcgacgacact
ggcccgtga

DBGET integrated database retrieval system