KEGG   Mus musculus (mouse): 81897
Entry
81897             CDS       T01002                                 

Gene name
Tlr9
Definition
(RefSeq) toll-like receptor 9
  KO
K10161  toll-like receptor 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05142  Chagas disease
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05152  Tuberculosis
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    81897 (Tlr9)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    81897 (Tlr9)
  09172 Infectious disease: viral
   05162 Measles
    81897 (Tlr9)
   05168 Herpes simplex virus 1 infection
    81897 (Tlr9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81897 (Tlr9)
   05152 Tuberculosis
    81897 (Tlr9)
  09174 Infectious disease: parasitic
   05144 Malaria
    81897 (Tlr9)
   05142 Chagas disease
    81897 (Tlr9)
   05143 African trypanosomiasis
    81897 (Tlr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    81897 (Tlr9)
   04090 CD molecules [BR:mmu04090]
    81897 (Tlr9)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   81897 (Tlr9)
CD molecules [BR:mmu04090]
 Proteins
  81897 (Tlr9)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_12 TIR LRR_5 LRR_9 TIR_2 LRR_6
Other DBs
NCBI-GeneID: 81897
NCBI-ProteinID: NP_112455
MGI: 1932389
Ensembl: ENSMUSG00000045322
Vega: OTTMUSG00000049422
UniProt: Q9EQU3
Structure
PDB: 
3WPF 3WPG 3WPI 5ZLN 3WPH

Position
9; 9 F1
AA seq 1032 aa
MVLRRRTLHPLSLLVQAAVLAETLALGTLPAFLPCELKPHGLVDCNWLFLKSVPRFSAAA
SCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCPPTGLSPLHFSCHMTIEPRTFL
AMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLDANSLAGLYSLRVLFMDGNCYY
KNPCTGAVKVTPGALLGLSNLTHLSLKYNNLTKVPRQLPPSLEYLLVSYNLIVKLGPEDL
ANLTSLRVLDVGGNCRRCDHAPNPCIECGQKSLHLHPETFHHLSHLEGLVLKDSSLHTLN
SSWFQGLVNLSVLDLSENFLYESITHTNAFQNLTRLRKLNLSFNYRKKVSFARLHLASSF
KNLVSLQELNMNGIFFRLLNKYTLRWLADLPKLHTLHLQMNFINQAQLSIFGTFRALRFV
DLSDNRISGPSTLSEATPEEADDAEQEELLSADPHPAPLSTPASKNFMDRCKNFKFTMDL
SRNNLVTIKPEMFVNLSRLQCLSLSHNSIAQAVNGSQFLPLTNLQVLDLSHNKLDLYHWK
SFSELPQLQALDLSYNSQPFSMKGIGHNFSFVTHLSMLQSLSLAHNDIHTRVSSHLNSNS
VRFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDNLPKSLKLLS
LRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNGTLLQKLDVSSNSIVSVVPA
FFALAVELKEVNLSHNILKTVDRSWFGPIVMNLTVLDVRSNPLHCACGAAFVDLLLEVQT
KVPGLANGVKCGSPGQLQGRSIFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLC
GWDVWYCFHLCLAWLPLLARSRRSAQTLPYDAFVVFDKAQSAVADWVYNELRVRLEERRG
RRALRLCLEDRDWLPGQTLFENLWASIYGSRKTLFVLAHTDRVSGLLRTSFLLAQQRLLE
DRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLFWPQQPNGQGGFWAQLSTALTRDNRHF
YNQNFCRGPTAE
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggttctccgtcgaaggactctgcaccccttgtccctcctggtacaggctgcagtgctg
gctgagactctggccctgggtaccctgcctgccttcctaccctgtgagctgaagcctcat
ggcctggtggactgcaattggctgttcctgaagtctgtaccccgtttctctgcggcagca
tcctgctccaacatcacccgcctctccttgatctccaaccgtatccaccacctgcacaac
tctgacttcgtccacctgtccaacctgcggcagctgaacctcaagtggaactgtccaccc
actggccttagccccctgcacttctcttgccacatgaccattgagcccagaaccttcctg
gctatgcgtacactggaggagctgaacttgagctataatggtatcaccactgtgccccga
ctgcccagctccctggtgaatctgagcctgagccacaccaacatcctggttctagatgct
aacagcctcgccggcctatacagcctgcgcgttctcttcatggacgggaactgctactac
aagaacccctgcacaggagcggtgaaggtgaccccaggcgccctcctgggcctgagcaat
ctcacccatctgtctctgaagtataacaacctcacaaaggtgccccgccaactgcccccc
agcctggagtacctcctggtgtcctataacctcattgtcaagctggggcctgaagacctg
gccaatctgacctcccttcgagtacttgatgtgggtgggaattgccgtcgctgtgaccat
gcccccaatccctgtatagaatgtggccaaaagtccctccacctgcaccctgagaccttc
catcacctgagccatctggaaggcctggtgctgaaggacagctctctccatacactgaac
tcttcctggttccaaggtctggtcaacctctcggtgctggacctaagcgagaactttctc
tatgaaagcatcacccacaccaatgcctttcagaacctaacccgcctgcgcaagctcaac
ctgtccttcaattaccgcaagaaggtatcctttgcccgcctccacctggcaagttccttt
aagaacctggtgtcactgcaggagctgaacatgaacggcatcttcttccgcttgctcaac
aagtacacgctcagatggctggccgatctgcccaaactccacactctgcatcttcaaatg
aacttcatcaaccaggcacagctcagcatctttggtaccttccgagcccttcgctttgtg
gacttgtcagacaatcgcatcagtgggccttcaacgctgtcagaagccacccctgaagag
gcagatgatgcagagcaggaggagctgttgtctgcggatcctcacccagctccgctgagc
acccctgcttctaagaacttcatggacaggtgtaagaacttcaagttcaccatggacctg
tctcggaacaacctggtgactatcaagccagagatgtttgtcaatctctcacgcctccag
tgtcttagcctgagccacaactccattgcacaggctgtcaatggctctcagttcctgccg
ctgactaatctgcaggtgctggacctgtcccataacaaactggacttgtaccactggaaa
tcgttcagtgagctaccacagttgcaggccctggacctgagctacaacagccagcccttt
agcatgaagggtataggccacaatttcagttttgtgacccatctgtccatgctacagagc
cttagcctggcacacaatgacattcatacccgtgtgtcctcacatctcaacagcaactca
gtgaggtttcttgacttcagcggcaacggtatgggccgcatgtgggatgaggggggcctt
tatctccatttcttccaaggcctgagtggcctgctgaagctggacctgtctcaaaataac
ctgcatatcctccggccccagaaccttgacaacctccccaagagcctgaagctgctgagc
ctccgagacaactacctatctttctttaactggaccagtctgtccttcctacccaacctg
gaagtcctagacctggcaggcaaccagctaaaggccctgaccaatggcaccctgcctaat
ggcaccctcctccagaaactcgatgtcagtagcaacagtatcgtctctgtggtcccagcc
ttcttcgctctggcggtcgagctgaaagaggtcaacctcagccacaacattctcaagacg
gtggatcgctcctggtttgggcccattgtgatgaacctgacagttctagacgtgagaagc
aaccctctgcactgtgcctgtggggcagccttcgtagacttactgttggaggtgcagacc
aaggtgcctggcctggctaatggtgtgaagtgtggcagccccggccagctgcagggccgt
agcatcttcgcgcaggacctgcggctgtgcctggatgaggtcctctcttgggactgcttt
ggcctttcactcttggctgtggccgtgggcatggtggtgcctatactgcaccatctctgc
ggctgggacgtctggtactgttttcatctgtgcctggcatggctacctttgctagcccgc
agccgacgcagcgcccaaactctcccttatgatgccttcgtggtgttcgataaggcacag
agcgcagttgccgactgggtgtataacgagctgcgggtgcggctggaggagcggcgcggc
cgccgagccctacgcttgtgtctggaggaccgagattggctgcctggccagacgctcttc
gagaacctctgggcttccatctatgggagccgcaagactctatttgtgctggcccacacg
gaccgcgtcagtggcctcctgcgcaccagcttcctgctggctcagcagcgcctgttggaa
gaccgcaaggacgtggtggtgttggtgatcctgcgtccggatgcccaccgctcccgctat
gtgcgactgcgccagcgtctctgccgccagagtgtgctcttctggccccagcagcccaac
gggcaggggggcttctgggcccagctgagtacagccctgactagggacaaccgccacttc
tataaccagaacttctgccggggacctacagcagaatag

DBGET integrated database retrieval system