KEGG   Mus musculus (mouse): 81904Help
Entry
81904             CDS       T01002                                 

Gene name
Cacng7
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81904 (Cacng7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    81904 (Cacng7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    81904 (Cacng7)
   04261 Adrenergic signaling in cardiomyocytes
    81904 (Cacng7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    81904 (Cacng7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    81904 (Cacng7)
   05414 Dilated cardiomyopathy (DCM)
    81904 (Cacng7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    81904 (Cacng7)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   81904 (Cacng7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin Claudin_3 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 81904
NCBI-ProteinID: NP_573452
MGI: 1932374
Ensembl: ENSMUSG00000069806
Vega: OTTMUSG00000057715
UniProt: P62956 B9EJ14
Position
7 A1; 7 1.95 cM
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgtttggtgcctgcggc
ctgctccttgtgggcatcgcggtcagcacggactactggctgtacatggaggaggggacc
gttttgccgcagaaccagaccaccgaggtcaagatggcgctgcacgctggcctctggaga
gtctgcttctttgcaggtcgggagaaggggcgctgtgtggcttctgagtactttcttgaa
ccagagatcaacttggtgacggaaaacacggagaatattctgaagacagtgcgcacggct
acacccttccctatggtcagtctcttcctcgtgttcaccgcctttgtcatcagcaacatc
ggccacatccgacctcagaggaccattcttgcgttcgtttctggcatctttttcatttta
tcaggtctctccttggtggtgggcttggtcctatacatctccagcatcaacgacgaggtc
atgaacaggcccagcagctctgagcagtactttcactatcgctacgggtggtcctttgcc
ttcgctgcttcctcttttcttctcaaagagggggccggagtcatgtccgtgtacttgttc
accaagcgctacgcggaggaagagatgtatcgcccgcacccggccttctaccgaccgcgt
ctcagcgactgctccgactactccggccagtttctgcagcccgaggcgtggcgtcgaggc
cgcagcccttccgacatctctagcgacgtctccattcagatgacgcaaaattaccccccg
gccatcaagtacccggaccatctccacatctccacttcgccgtgctga

DBGET integrated database retrieval system