KEGG   Mus musculus (mouse): 81910
Entry
81910             CDS       T01002                                 

Gene name
Rrbp1, 1700087N07Rik, 5730465C04Rik, ES/13, ES/130, mKIAA1398, mR, mRR, mRRp0, mRRp1, mRRp1.8, mRRp10, mRRp15a, mRRp15b, mRRp16.8, mRRp2, mRRp41, mRRp47, mRRp5.4, p18, p180
Definition
(RefSeq) ribosome binding protein 1
  KO
K14000  ribosome-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81910 (Rrbp1)
SSDB
Motif
Pfam: Rib_recp_KP_reg ABC_tran_CTD ABC_export
Other DBs
NCBI-GeneID: 81910
NCBI-ProteinID: NP_077243
MGI: 1932395
Ensembl: ENSMUSG00000027422
Vega: OTTMUSG00000003227
UniProt: Q99PL5 A2AVJ7 Q8CAB9
Position
2; 2 G1
AA seq 1464 aa
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKGEKK
KKEKTVEKKGKTKKKEEKPNGKIPEHDLDPNVTIILKEPVRVSAVAVAPTSVHSSVGHTP
IATVPAMPQEKLASSPKDRKKKEKKVAKVEPAVSSIVNSIQVLASKSAILEATPKEVPMV
AVPPVGSKASSPATSSQGKKGQGAQNQAKKGEGAQNQGKKGEGAQNQAKKGEGAQNQAKK
GEGAQNQGKKGEGAQNQAKKGEGGQNQAKKGEGAQNQGKKGEGAQNQGKKGEGAQNQAKK
GEGAQNQAKKGEGAQNQGKKGEGAQNQSKKGEGAQNQAKKGEGGQNQAKKGEGAQNQAKK
GEGAQNQAKKGEGVQNQAKKGVEGAQNQGKKGEANQNQAKKGEGGQNQTKKGEGPQNQGK
KGEAAQKQDKKIEGAQNQGKKPEGTSNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGK
KGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGPQNQAKKGEGAQNQGK
KGEGAQNQGKKGEGAQNQGKKAEGVQSQSKKGEGTQNQGKKGDGNPNQGKKGEGASNQNR
KTDTVANQGTKQEGVSNQVKKSEGSPNQGKKAEGAPNQGKKKDGSPSQAKKVDAAANQGK
KSEMAPAQGQKASMVQSQEAPKQDAPAKKKSGSRKKGEPGPPDCDGPLFLPYKTLVSTVG
SMVFSEGEAQRLIEILSEKTGVIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAV
AKSKLRELNKEMASEKAKAAAGEAKVKKQLVAREQEIAAVQARMQASYRDHVKEVQQLQG
KIRTLQEQLENGPNTQLARLQQENSILRDALNQATSQVESKQNTELAKLRQELSKVNKEL
VEKSEASRQEEQQRKALEAKAATFEKQVLQLQASHKESEEALQKRLEEVTRELCRAQTSH
ANLRADAEKAQEQQQRVAELHSKLQSSEVEVKSKCEELSSLHGQLKEARAENSQLTERIR
SIEALLEAGQAQDTQASHAEANQQQTRLKELESQVSCLEKETSELKEAMEQQKGKNNDLR
EKNWKAMEALALAERACEEKLRSLTQAKEESEKQLHLAEAQTKETLLALLPGLSISAHQN
YAEWLQEFKEKGSELLKKPPTLEPSMDIVLKLREAEETQNSLQAECDQYRTILAETEGML
KDLQKSVEEEERVWKAKVGAAEEELHKSRVTVKHLEDIVEKLKGELESSDQVREHTSHLE
AELEKHMAAASAECQNYAKEVAGLRQLLLESQSQLDEAKSEAQKQSDELALVRQQLSDMR
SHVEDGDVAGSPAVPPAEQDPMKLKTQLERTEATLEAEQTRRQKLTAEFEEAQRTACRIQ
EELEKLRAAGPLESSGKEEITQLKERLEKEKRLTSDLGRAAIKLQELLKTTQEQLTKEKD
TVKKLQEQLGKAEDGSSSKEGTSV
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggatatctacgacactcagaccttgggggttgtggtctttggcgggtttatggttgtt
tctgccatcggcatcttcctggtgtcaaccttctccatgaaggagacgtcgtatgaagaa
gcccttgccaaccagcgcaaggagatggcgaaaactcaccaccagaaaggagagaagaaa
aagaaggagaaaaccgtggagaagaaaggaaagaccaagaaaaaggaagagaaacctaat
gggaagatacctgaacatgacctggatcccaacgtgaccatcatcctcaaggaaccagtg
cgtgtatccgctgtggctgtggctccaacttcagtccattcttctgtgggccatacccct
atagccacagtaccagccatgcctcaggaaaagctggcttcctcccctaaggacagaaag
aagaaggagaaaaaagtggcaaaggtggagccagcagtcagttctattgtgaattccatc
caggttcttgcttcaaagtctgccatcttggaagccacacccaaggaggtgcctatggtg
gctgtgcctccagtgggctctaaggccagttctcctgccaccagcagtcagggcaagaag
ggacagggagcccagaaccaggccaagaagggggagggagcccagaaccaaggcaagaag
ggagagggggcccagaaccaagctaagaaaggagagggggcccagaaccaggccaagaag
ggggagggggcccagaaccaaggcaagaagggggagggagcccagaaccaggccaagaag
ggggaaggaggccagaaccaggccaagaagggggagggggcccagaaccaaggcaagaag
ggagagggggcccagaaccaaggcaagaagggggagggagcccagaaccaggctaagaag
ggggagggggctcagaaccaagctaagaagggtgagggggcccagaaccaaggcaagaag
ggagagggggcccagaaccagtccaagaaaggagagggggctcagaaccaggccaagaag
ggggaagggggccaaaaccaggccaagaagggagagggggctcagaaccaggccaagaag
ggggagggagcccagaaccaagctaagaagggggagggggtccagaaccaggccaagaag
ggggtagaaggggcccaaaatcagggcaaaaagggggaagcaaaccaaaaccaggctaag
aagggtgagggaggccagaaccaaaccaagaagggggaaggaccccagaaccaaggcaag
aagggagaagcagctcaaaaacaggacaaaaaaatagaaggagcccagaatcaaggcaag
aagccagagggaacctcaaaccaaggcaagaagggggagggggcccagaaccaaggcaag
aagggagagggggcccagaaccaaggcaagaagggagagggggcccagaaccaaggcaag
aagggagagggggcccagaaccaaggcaagaagggagagggggcccagaaccaaggcaag
aagggagagggggcccaaaaccaaggcaagaagggagagggggcccagaaccaaggcaag
aagggagaggggccccagaaccaggccaagaaaggagagggggcccagaaccagggcaag
aaaggagagggggcccagaaccagggcaagaaaggagagggggcccagaaccagggcaaa
aaggcagagggggttcaaagtcagagcaagaaaggggaagggacccagaatcagggcaaa
aagggggatggaaatcccaaccaaggcaagaagggggagggggcttccaaccagaacaga
aagacagatacagttgctaatcagggcacaaagcaagagggtgtctcaaaccaggtgaaa
aagtcagaagggtcccctaatcaaggtaaaaaggcagagggagccccaaaccaaggcaaa
aagaaagatggatcccccagccaggccaaaaaagtggatgcagctgccaatcagggtaaa
aagtcagagatggctcctgcccagggtcaaaaggcaagcatggtccagagccaggaggca
ccaaagcaagacgcacctgcaaagaagaagtctggttccaggaaaaaaggagagcctggg
cccccagattgcgacggccctctcttcctgccctacaagacactggtctctacggttgga
agcatggtgttcagtgagggcgaggcccagcggcttattgagattctctctgagaagact
ggagtcattcaagacacctggcataaggccactcagaagggtgaccctgtagcaattctg
aaacgccaactagaagagaaagaaaagctgctggccacagagcaagaggatgcggccgtc
gccaagagcaagctaagggaactcaacaaggagatggcttcagagaaggccaaggctgca
gctggggaggccaaagtgaagaagcagctggtagcccgggagcaggagatcgcagctgtg
caggcacgcatgcaggccagctatcgggaccatgtgaaggaggtgcaacagctgcagggc
aagatccggactcttcaggaacagctggagaatggccctaacacccagctggcccgccta
cagcaggagaactccatcttgagggatgccttgaaccaggctaccagccaggtggaaagc
aagcagaacacagaactggcaaagctccgacaggagctcagcaaggtcaacaaggagcta
gtggagaagtcagaggcctcccggcaggaggagcaacaacggaaggcgctggaagccaag
gcagccacctttgagaagcaggtcctacagttgcaggcatcccacaaagagagtgaagag
gctctgcagaagcgcttggaggaggtcacccgggaactctgccgggcacaaacgagccat
gccaacctccgagcggatgctgaaaaggctcaggaacagcagcagcgagtggcagagttg
cacagcaaattacagtcatctgaggtggaggtaaaaagcaagtgtgaagagctgagtagt
ctccatgggcagctcaaggaggccagggcggagaactcacagctcacagagaggatccgt
tccatcgaagcccttctggaagcaggccaggcccaagacacccaggccagccacgctgag
gccaaccagcagcagactcgtctcaaggagctggagtcccaggtgtcgtgtctggagaag
gaaaccagtgagctcaaggaggctatggaacaacagaaggggaagaacaatgacctccgg
gaaaagaactggaaggccatggaggcactggccttagctgagcgggcctgtgaggagaag
ctgcgttccctaacccaggccaaggaggagtcagaaaagcagctgcacctggctgaggcc
cagaccaaggagaccctgctggccttgcttccggggctctctatctcagcacaccagaac
tatgccgagtggctacaggaattcaaagagaagggctctgagctgctgaagaaaccacct
accctagagccctccatggacatagtcttgaagttgagggaagctgaggagacccaaaac
tctttgcaggctgagtgtgaccagtaccgcaccatcctggcagagacggagggcatgctc
aaagacctgcagaagagtgtggaggaagaagagcgagtgtggaaggccaaggtgggagct
gctgaggaggagctgcacaagtcacgggtcacagtgaaacatctagaagacattgtggag
aagctaaaaggagaacttgaaagctcagatcaggtaagggagcacacatcacatctggaa
gcggagctggagaagcacatggcagcggccagtgcagagtgtcagaattatgccaaggag
gtggcagggttaaggcagcttctgctagaatcgcagtctcagctggatgaagccaagagt
gaagcccagaaacaaagcgatgagcttgccctggtcaggcagcagttgagtgacatgagg
agccacgtagaggatggtgacgtggctgggtctccagctgtccctccagccgagcaggac
cctatgaagttgaaaacacagctggagcggacagaagccaccctggaggctgagcagaca
cggcggcagaagctcacagctgagtttgaggaggctcaacgcacagcgtgtcggatacaa
gaagagctggagaaactccgtgctgctggccccctggagtcgtcaggaaaagaagagatt
acacagctgaaggagagactagaaaaagagaagaggttaacaagtgacctgggccgtgct
gccatcaaacttcaggagctgttgaagacaacccaggagcagctgacgaaagagaaggac
acagtgaagaagttacaagaacaactgggaaaagcagaggatggtagcagctcaaaggag
ggaacctctgtctga

DBGET integrated database retrieval system