KEGG   Mus musculus (mouse): 83396
Entry
83396             CDS       T01002                                 

Symbol
Glis2, Gli5, Klf16, Nkl
Name
(RefSeq) GLIS family zinc finger 2
  KO
K09233  zinc finger protein GLIS2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    83396 (Glis2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    83396 (Glis2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 FOXP-CC zf-met zf-C2H2_jaz
Other DBs
NCBI-GeneID: 83396
NCBI-ProteinID: NP_112461
MGI: 1932535
Ensembl: ENSMUSG00000014303
Vega: OTTMUSG00000026679
UniProt: Q8VDL9
Position
16:4412217..4443076
AA seq 521 aa
MHSLDEPLDLKLSITKLRAAREKRERTLGVVRHHALHRELGLVDDSPAPGSPGSPPPGFL
LNPKFPEKVDGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPECQGNGDLPPLPTAVDFQPL
RYLDGVPSSFQFFLPLGSGGALHLPASSFLPPPKDKCLSPELPLAKQLVCRWAKCNQLFE
LLQDLVDHVNDHHVKPEQDARYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC
NKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPTPDSGSYVSGAQIIIPNPAA
LFGGPSLPGLPLPLPPGPLDLSALACGNGGGGGGGIGPGLPGSVLPLNLAKNPLLPSPFG
AGGLGLPVVSLLGGSAGSKAEGEKGRGSVPARVLGLEDHKTPLERTERSRSRPSPDGLPL
LPGTVLDLSTGNSAASSPEVLTPGWVVIPPGSVLLKPAVVN
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcactccttggacgagcccctcgacctaaagctgagcatcaccaagctccgagcggca
agagagaagagagaaaggacactgggtgtggtccggcatcatgctttgcatcgagagctg
ggcctggtggacgatagccccgcccctggctccccaggctctccaccaccaggtttcctg
ctgaaccccaaattccctgagaaggtggacggacgcttttctgcagcccccttggtggac
ctcagcttgtcaccaccctctggactggactctcccaatggcagcagctccctgtctcct
gagtgccagggcaatggggacttgcctccactgcctactgctgtggatttccagccactt
cgctatttggatggtgtccccagttccttccagttcttcttgcccctgggttctggtggg
gctctgcacctacctgcttcctccttccttcccccccccaaggacaagtgcctctcacca
gagctgcccctggccaagcagctggtgtgtcgatgggccaagtgtaaccagctctttgag
ctcctccaagacctggttgaccatgtcaacgaccatcatgtcaagcctgaacaggatgct
cgatactgctgtcattgggagggctgcgcccgccatggccgtggcttcaatgccaggtac
aagatgctcattcacatccggacacacaccaacgagaagccgcaccgatgccccacctgt
aacaagagcttctcccgcctggagaacctgaagatccacaaccgctcccacacaggtgag
aagccctacgtctgcccctatgagggctgcaacaagcgttactccaactccagtgaccgc
ttcaagcacacccgtacccactacgtagacaagccctactactgcaagatgcccggctgt
cacaagcgttacacggaccccagttcactgcgcaaacacatcaaggcccatggccacttt
gtgtcacatgagcagcaggagctcctgcagctgcgcccaccccctaaaccaccactgccc
actcctgacagtggctcctatgtcagcggggctcagatcatcatcccgaaccctgctgcc
ctttttggaggccccagtctgcctggcctgccattacctctacctcctggcccccttgac
ctcagtgctctggcctgtggcaatggtggaggtgggggtgggggtattggccctgggctg
ccaggctctgttctgcccctcaatctggccaagaacccgctgttgccctcaccctttggg
gctggtggactaggcctgcctgtggtttctctcctgggtggctctgccggtagcaaggcc
gagggggagaagggtcgtgggtcagtacctgccagggtcctgggcctggaagatcacaag
acgcccctggaaaggacggagcgcagccgctcccggccaagccctgatggactccctttg
ctcccaggcactgtactggacctgtccacaggcaactcagcagccagcagtccagaggtg
ttaactcctggctgggtggtcattccaccagggtctgtgctgctcaaaccagctgtggta
aactga

DBGET integrated database retrieval system