KEGG   Mus musculus (mouse): 83397
Entry
83397             CDS       T01002                                 

Gene name
Akap12, AI317366, SSe, SSeCKS, Sr, Srcs5, Tsga, Tsga12
Definition
(RefSeq) A kinase (PRKA) anchor protein (gravin) 12
  KO
K16528  A-kinase anchor protein 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    83397 (Akap12)
SSDB
Motif
Pfam: WSK RII_binding_1
Other DBs
NCBI-GeneID: 83397
NCBI-ProteinID: NP_112462
MGI: 1932576
Ensembl: ENSMUSG00000038587
Vega: OTTMUSG00000063494
UniProt: Q9WTQ5 B2RRE0
Position
10; 10 A1
AA seq 1684 aa
MGAGSSTEQRSPEQPAESDTPSELELSGHGPAAEASGAAGDPADADPATKLPQKNGQLSA
VNGVAEQEDVHVQEESQDGQEEEVTVEDVGQRESEDVKEKDRAKEMAASSTVVEDITKDE
QEETPEIIEQIPASESNVEEMAQAAESQANDVGFKKVFKFVGFKFTVKKDKNEKSDTVQL
LTVKKDEGEGAEASVGAGDHQEPGVETVGESASKESELKQSTEKQEGTLKQAQSSTEIPL
QAESGQGTEEEAAKDGEENREKEPTKPLESPTSPVSNETTSSFKKFFTHGWAGWRKKTSF
KKPKEDDLETSEKRKEQEAEKVDEEEGEKTEPAPAEEQEPAEGTDQARLSADYEKVELPL
EDQVGDLEALSEKCAPLATEVFDEKTEAHQEVVAEVHVSTVEKMTKGQGGAEVEGDVVVE
GSGESLPPEKLAETQEVPQEAEPVEELMKTKEVCVSGGDHTQLTDLSPEEKMLPKHPEGI
VSEVEMLSSQERIKVQGSPLKKLFSSSGLKKLSGKKQKGKRGGGGGDEEPGEYQHIQTES
PESADEQKGESSASSPEEPEEIACLEKGPSEAPQEAEAEEGATSDGEKKREGITPWASFK
KMVTPKKRVRRPSESDKEEELDKVKSATLSSTESTASGMQDEVRAVGEEQRSEEPKRRVD
TSVSWEALICVGSSKKRARKASSSDDEGGPRTLGGDGHRAEEASKDKEADALPASTQEQD
QAHGSSSPEPAGSPSEGEGVSTWESFKRLVTPRKKSKSKLEERAEDSGAEQLASEIEPSR
EESWVSIKKFIPGRRKKRADGKQEQAAVEDSGPGEINEDDPDVPAVVPLSEYDAVEREKL
EAQRAQENVELPQLKGAVYVSEELSKTLVHTVSVAVIDGTRAVTSAEERSPSWISASMTE
PLEHAEGVATPPVGEVTEKDITAEATPALAQTLPGGKDAHDDIVTSEVDFTSEAVTAAET
TEALRAEELTEASGAEETTDMVSAVSQLSDSPDTTEEATPVQEVEGGMLDTEEQERQTQA
VLQAVADKVKEDSQVPATQTLQRAGPKALEKVEEVEEDSEVLATEKEKDVVPEGPVQEAE
TEHLAQGSETVQATPESLEVPEVTEDVDRATTCQVIKHQQLMEQAVAPESSETLTDSETN
GSTPLADSDTPNGTQQDETVDSQDSNAIAAVKQSQVTEEEAAAAQTEGPSTPSSFPAQEE
HREKPGRDVLEPTQALAAGAVPILAKAEVGQEGEAGQFDGEKVKDGQCVKELEVPVHTGP
NSQKTADLTRDSEVMEVARCQETESNEEQSISPEKREMGTDVEKEETETKTEQASEEHEQ
ETAAPEHEGTHPKPVLTADMPHSERGKALGSLEGSPSLPDQDKADCIEVQVQSSDTPVTQ
TTEAVKKVEETVATSEMDESLECAGAQSLPAEKLSETGGYGTLQHGEDTVPQGPESQAES
IPIIVTPAPESILHSDLQREVSASQKQRSDEDNKPDAGPDAAGKESAAREKILRAEPEIL
ELESKSNKIVQSVIQTAVDQFARTETAPETHASDLQNQVPVMQADSQGAQQMLDKDESDL
QVSPQDGTLSAVAQEGLAVSDSSEGMSKASEMITTLAVESASVKESVEKLPLQCKDEKEH
AADGPQHQSLAKAEADASGNLTKESPDTNGPKLTEEGDALKEEMNKAQTEEDDLQEPKGD
LTES
NT seq 5055 nt   +upstreamnt  +downstreamnt
atgggtgcaggcagttccaccgagcagcggagccccgagcagccggcggagagcgacacg
ccgagcgagctggagctcagtggccatgggcccgcagcggaagcgtcgggagcagctgga
gatcccgctgacgcggaccccgccaccaagctcccacagaagaatggtcagctgtctgcc
gtcaatggtgtagctgaacaagaagatgtccacgtccaagaggaaagccaggatgggcaa
gaggaagaagtcactgttgaagatgttggacagagagagtcagaagatgtgaaagaaaaa
gaccgagctaaagaaatggcagccagttccacagttgttgaagatatcacaaaggacgag
caggaggaaacaccggaaataatcgaacagatccctgcttcagagagcaatgtggaagaa
atggcgcaggctgctgagtcccaagctaatgacgtcggcttcaagaaggtatttaaattt
gttggttttaaattcacggtgaagaaggataaaaacgaaaagtcagataccgtccagcta
ctcactgtcaagaaggatgaaggcgaaggggcagaagcctccgtcggagcaggagaccac
caagagcccggagtggagaccgtcggcgaatcagcatccaaagaaagtgagctgaagcaa
tccacagagaagcaagaaggcaccctgaagcaagcacagagcagcacagaaattcccctt
caagccgaatctggtcaagggaccgaggaagaagcagccaaagatggagaagaaaaccga
gagaaagaacctaccaagcccctagaatctccgaccagccctgtcagcaatgagacaaca
tcttccttcaagaaattcttcactcacggctgggccggctggcgcaagaagaccagcttc
aagaaaccaaaggaagatgatctggaaacttccgagaagagaaaggagcaagaggctgaa
aaagtagacgaggaagaaggggaaaagacagagccagccccagccgaggagcaggagcct
gcagaaggcacagaccaggccaggttgtcagccgactatgagaaggtggagttgcctttg
gaagaccaggtcggtgacctggaggcattgtcggagaagtgtgctcctttggcaacggaa
gtgtttgatgagaagacggaagcccaccaagaagttgttgcagaggtccacgtgagcacc
gtggagaagatgacgaaagggcaaggaggagcagaggtggaaggggatgtggtggtggaa
ggatcgggagaatccttgccccctgagaaactggctgagacccaggaggtcccccaggaa
gctgagcctgtggaggagctgatgaagaccaaagaagtatgcgtctctgggggtgaccat
actcagctgacagatctaagtcctgaagagaagatgctacccaaacaccccgaaggcatt
gtcagtgaggtggagatgctgtcctctcaggagagaatcaaggtacagggaagtcccctg
aagaagctcttcagcagttcgggcttaaagaagctctccgggaagaagcagaaggggaag
agaggaggaggcgggggagatgaagagccaggagaataccaacacattcaaaccgagtcc
ccagagagtgctgacgagcagaagggagagagctctgcctcttcccctgaagagcccgag
gagatcgcgtgtctggagaaggggccatcggaagcaccccaggaagcggaagctgaggaa
ggagcgacttccgacggagagaagaaaagggaagggatcaccccctgggcatccttcaaa
aagatggtgacacccaagaaacgggtccgaagaccttctgagagcgacaaggaagaagag
ctggataaggtcaagagtgccaccttgtcctccacggagagcacggcgtctggaatgcag
gatgaggtcagagcggttggcgaggagcaaaggtcagaggagccaaagcgcagggtggat
acttcagtgtcttgggaggcgttgatttgtgtcggatcgtccaagaagagagcgaggaag
gcatcctcttcagatgatgaaggagggccaagaacactgggaggggatggccacagagcg
gaggaggctagcaaagacaaagaagcagatgctcttcctgccagcacccaggaacaagac
caagcgcacggaagttcctcacccgagccagctggaagcccttctgaaggggagggcgtc
tccacctgggagtcatttaagagattagtcactccacgaaaaaaatccaagtcaaaactg
gaagagagagccgaagactccggtgcagagcagttggcctccgagatcgaaccaagtaga
gaggaatcttgggtttccattaagaaatttattcctggacggcggaagaaaagggcagat
gggaagcaagaacaggccgccgttgaagactcggggccaggagagatcaatgaggacgac
cccgacgtcccagctgttgtgcctctgtctgagtacgatgcggtagagagagagaagctg
gaagcgcagcgagctcaggagaacgtggagctgccccagctgaagggggctgtgtatgtg
tctgaggagcttagtaagactctggttcacaccgtgagtgtcgcggtcattgatgggacc
agggcagtcaccagtgccgaagagcggtccccttcgtggatatctgcttccatgacagaa
cctcttgagcacgcagagggagtggccacaccgcctgttggagaggtcactgaaaaagac
atcactgcagaagcaactcctgcactcgcccagactttaccagggggcaaagatgcccat
gacgacatagtcaccagtgaagtggattttacctcagaagcagtgacagccgcagaaacc
acagaggcgctccgcgctgaagaacttaccgaagcatcaggggcagaagagaccacagac
atggtgtctgcagtttcccagctgtccgactccccggacaccacagaggaagccacccca
gttcaggaggtagagggtggcatgctagatacggaagaacaggagcgccagacgcaggcc
gtcctccaagccgttgcagacaaagtgaaagaggactcccaggtgcctgcaacccagact
ctgcagagagcagggccgaaagcactggagaaggtggaggaggtagaggaggactccgag
gtgctggctaccgagaaagagaaggatgttgtgccggaaggacccgtgcaggaagctgaa
actgagcatcttgcacagggctccgagactgtacaggctaccccagagagccttgaagtt
cctgaagtcacagaggatgtagaccgtgccaccacatgccaggttatcaagcaccagcag
ctgatggaacaggctgtggcccctgagtcatctgaaaccttgacagacagtgagacaaat
ggaagtactcccctcgcagattcagacactccaaacgggacacagcaagacgagaccgtt
gacagccaggacagtaatgccattgccgccgtcaagcagtcacaggtcactgaagaggag
gcagctgctgctcagacggaggggccttcaacaccatctagttttccagcccaggaagaa
cacagggaaaaaccaggaagggatgttctagaacccacacaagcgctggctgccggggca
gtgcctattctggcaaaggctgaggtgggtcaagagggtgaggctggccagtttgatgga
gaaaaagtcaaagacggacagtgtgttaaagaactggaggtgcctgtgcacactggaccc
aacagtcaaaagactgctgacttgacacgtgacagtgaagtaatggaagtggccagatgt
caggaaactgagagtaatgaagaacagagtattagcccggagaaaagagagatgggaacc
gacgttgaaaaggaggaaacagagaccaagacagagcaagccagtgaagaacatgagcag
gaaacagctgctcctgagcatgaaggaacccaccctaagccagtcctgacagctgacatg
cctcactcagagaggggaaaggcactgggcagccttgaaggaagcccttctctcccagac
caagacaaagcagattgcatagaggttcaagttcaaagctcagacacaccagtcactcaa
acaaccgaagctgtgaaaaaggtcgaagaaactgtggcaacttcagagatggatgaaagt
ttggagtgtgcaggtgcgcaatcattaccagctgagaagctctccgaaaccggtggctac
gggactcttcagcatggagaggacaccgtgccccaggggcctgagtctcaggcagagtcc
atcccaataatagtaactcctgctcctgaaagcatcctacattctgaccttcaaagagaa
gtgagcgcatcccagaaacagagatcagatgaagataacaagccagatgctggtcctgat
gctgccggcaaggagagtgcagcaagagagaaaatcctcagggctgaacctgagatcttg
gaacttgagagtaagagcaataagattgtccagagtgtcatccagacagccgtcgaccag
tttgcacgtacagaaacagcccccgaaacccacgcttctgatttacagaatcaggttcct
gtgatgcaggctgacagccagggagcacaacagatgctggacaaagatgaaagcgacctt
caagtctccccccaagatggaacactcagtgccgtagcccaggaaggacttgcggtttct
gatagttctgaaggcatgagcaaggcttcagaaatgatcaccacgcttgcagttgaaagt
gccagtgtcaaagaaagtgttgagaagctgcctcttcagtgcaaagatgaaaaggaacat
gctgctgacggcccccagcaccaaagcttagccaaggcagaggcggatgcctctggaaat
ctaaccaaagagtccccagacaccaacggaccaaagctaaccgaggaaggagatgccctg
aaagaagaaatgaacaaggcccagacagaagaggacgacctacaggagccaaagggagac
ctgacagaatcctaa

DBGET integrated database retrieval system