KEGG   Mus musculus (mouse): 83398
Entry
83398             CDS       T01002                                 

Symbol
Ndst3, 4921531K01Rik, 4930511P15Rik, N-HSST_3, NDST-3
Name
(RefSeq) N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
  KO
K02578  heparan sulfate N-deacetylase/N-sulfotransferase NDST3 [EC:3.1.1.- 2.8.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mmu01100  Metabolic pathways
Module
mmu_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    83398 (Ndst3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    83398 (Ndst3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     83398 (Ndst3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     83398 (Ndst3)
Glycosyltransferases [BR:mmu01003]
 Unclassified
  Sulfotransferases
   83398 (Ndst3)
SSDB
Motif
Pfam: HSNSD Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 83398
NCBI-ProteinID: NP_112463
MGI: 1932544
Ensembl: ENSMUSG00000027977
Vega: OTTMUSG00000025124
UniProt: Q9EQH7 E9PZJ4
Position
3; 3 G1
AA seq 873 aa
MSFIMKPHRHFQRTLILLATFCMVSIIISAYYLYSGYKQESEVSGRASEVDCGDLQHIPS
RLMEVRRTMISDASRTDPTVLVFVESQYSSLGQDIIMMLESIRFHYHTEIAPGKGDLPAL
TDNVKGKYVLIIYENILKYINMDSWNRSLLDKYCIEYGVGIIGFHKTSEKNLQSFQFRGF
PFSISGNLAVKDCCINPHSPLLRVTKSSKLDRGSLPGTDWTVFQINHSTYQPVIFAKVKT
PENLSPPISKHAFYATIIHDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLS
LDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRTQITNFTFNLGFSGKFYHTGTEE
EDEGDDCLLGSVDEFWWFPHMWSHMQPHLFHNESSLIEQMILNKKFALEHGIPTDMGYAV
SPHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARYRRGFIHKNIMVLPRQTCGLF
THTIFYKEYPGGPRELDKSIHGGELFFTVVLNPISIFMTHLSNYGNDRLGLYTFVNLANF
VQTWTNLRLQTLPPAQLAHKYFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLV
IGPQKTGTTALCLFLIMHPSILSNSPSPKSFEEVQFFNRNNYHRGIDWYMDFFPVPSNVT
TDFLFEKSANYFHSEDAPKRAASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALKFS
FYEVISAGPNAPWELRTLQKRCLVPGWYANHIERWLVYFPPFQLLIIDGQQLRTTPATVM
DEVQKFLGVSPHYNYSEALTFDSHKGFWCQLLEEGKTKCLGKSKGRKYPPMDSDSRAFLS
SYYRDHNVELSKLLHRLGQPLPSWLRQELQKVR
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgagttttatcatgaaacctcacagacactttcagagaacactgattctgcttgccacc
ttttgtatggtaagcattattatttctgcttactacctgtacagcggctacaaacaggaa
agtgaagtctccgggcgggcttcggaagtggactgtggtgacctccagcacataccatcc
aggctgatggaagtgaggaggacaatgatttccgatgcttcaaggacagaccccacagtc
ctggtgtttgtggagagccagtactcatcccttggtcaagacatcattatgatgctagaa
tccatccggttccattatcacactgaaatcgctcctggaaaaggagatcttccggcactt
acagacaatgtgaagggcaaatatgttctcattatatatgagaatattctaaagtatata
aacatggactcttggaatagaagccttttagataaatactgtatagagtatggtgtgggt
atcattggattccataaaaccagtgagaaaaatctacagagctttcagttcaggggcttc
cccttttccataagtggaaacctggcagtaaaagattgctgtattaatcctcactcccca
ctccttcgtgtgaccaaatcatccaagctggacagaggttctctacctggaactgactgg
acagtttttcagattaaccactccacctaccagccagtaatatttgccaaagttaagact
ccagaaaacctttctcctcccatctctaaacatgcattttatgccactatcatacacgac
ctggggcttcatgacgggatccagcgagttctttttggcaacaacttgaacttctggcta
cacaagctcatcttcatagacgccatctccttcttgtcggggaagaggctgacactgtcc
ttggacaggtacatccttgtggacattgacgacatatttgtagggaaggagggcacaagg
atgaacaccaatgatgtgaaggccctgcttgacactcagaatcttttgcgcacacaaatc
acaaattttacattcaaccttggattttcagggaaattttatcacacaggaactgaagag
gaagatgaaggggatgattgtctgctgggttctgtggacgagttctggtggtttcctcac
atgtggagtcacatgcagccccacctcttccacaatgagtcgtctttaatagagcagatg
attctcaacaaaaagtttgccttagagcacggcatccctaccgatatgggatatgcagtg
tcccctcaccattcaggtgtctaccctgtccatgttcagctttatgaggcctggaagaag
gtttggaatattaaaatcaccagcactgaagaatatccacatctgaaaccagctagatat
cggagaggcttcattcacaaaaacatcatggttctcccaagacaaacctgtgggctcttc
acccacacaattttctacaaggagtatccagggggtcccagggaactggacaagagtatt
catggaggggagctcttcttcactgtggttctcaacccaatcagtattttcatgacccat
ttgtctaactatggaaacgaccgactgggattatatacatttgtgaatctagccaatttt
gtgcagacctggaccaacctgcgtcttcagaccttgcctccagctcagctggctcacaag
tattttgagctctttcctgatcagaaagaccctctctggcagaacccctgtgatgacaaa
cgccacagagacatttggtctaaagagaaaacctgcgatcgtttaccaaaattcttggta
ataggaccccagaaaactggtaccactgccttgtgtctgttcctgattatgcatccttcc
atccttagtaactcccccagcccaaaatcctttgaggaggtacagttctttaatagaaat
aactaccacagggggattgattggtacatggatttcttcccagtcccatctaatgtcacc
actgactttctgtttgagaagagtgctaattacttccattcagaggacgctcccaagagg
gctgcttctctagtcccgaaagccaaaatcatcaccatactcattgacccgtcagaccga
gcgtactcctggtatcagcatcagcgatcccatgaagaccctgcagctctgaaatttagc
ttctatgaagtgatctctgctgggcccaatgcaccctgggaactccgaaccctgcagaag
agatgcctggtccctgggtggtatgccaaccacatcgagagatggcttgtttatttccct
ccatttcagttgctaatcattgatggacagcagctaagaactacccctgcgacagtgatg
gatgaagtccagaagtttctaggagtctcacctcattataattactccgaagctttaacg
tttgattctcataaaggcttctggtgtcagctgctggaagaagggaaaacaaaatgcctt
gggaagagtaaaggaagaaaataccccccgatggactctgatagcagagcgtttctgtcc
agctactaccgcgaccacaacgtggagctctcgaagctgctgcacaggctggggcagcct
ctgccctcctggctgagacaggagctgcagaaagtgaggtag

DBGET integrated database retrieval system