KEGG   Mus musculus (mouse): 83430
Entry
83430             CDS       T01002                                 

Gene name
Il23a, IL-23, p19
Definition
(RefSeq) interleukin 23, alpha subunit p19
  KO
K05426  interleukin 23 subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05133  Pertussis
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    83430 (Il23a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    83430 (Il23a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    83430 (Il23a)
   04659 Th17 cell differentiation
    83430 (Il23a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83430 (Il23a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    83430 (Il23a)
   05321 Inflammatory bowel disease
    83430 (Il23a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    83430 (Il23a)
   05152 Tuberculosis
    83430 (Il23a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    83430 (Il23a)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   83430 (Il23a)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 83430
NCBI-ProteinID: NP_112542
MGI: 1932410
Ensembl: ENSMUSG00000025383
UniProt: Q9EQ14
Position
10; 10 D3
AA seq 196 aa
MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREE
EDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDS
PMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARV
FAHGAATLTEPLVPTA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctggattgcagagcagtaataatgctatggctgttgccctgggtcactcagggcctg
gctgtgcctaggagtagcagtcctgactgggctcagtgccagcagctctctcggaatctc
tgcatgctagcctggaacgcacatgcaccagcgggacatatgaatctactaagagaagaa
gaggatgaagagactaaaaataatgtgccccgtatccagtgtgaagatggttgtgaccca
caaggactcaaggacaacagccagttctgcttgcaaaggatccgccaaggtctggctttt
tataagcacctgcttgactctgacatcttcaaaggggagcctgctctactccctgatagc
cccatggagcaacttcacacctccctactaggactcagccaactcctccagccagaggat
cacccccgggagacccaacagatgcccagcctgagttctagtcagcagtggcagcgcccc
cttctccgttccaagatccttcgaagcctccaggcctttttggccatagctgcccgggtc
tttgcccacggagcagcaactctgactgagcccttagtgccaacagcttaa

DBGET integrated database retrieval system