KEGG   Mus musculus (mouse): 83431
Entry
83431             CDS       T01002                                 

Gene name
Ndel1, 2600006O07Rik, MITAP1, NUDEL, mNudE-L, mNudel
Definition
(RefSeq) nudE neurodevelopment protein 1 like 1
  KO
K16739  nuclear distribution protein NudE-like 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    83431 (Ndel1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Nde1-Su48 complex
    83431 (Ndel1)
SSDB
Motif
Pfam: NUDE_C TPR_MLP1_2 PRKG1_interact HALZ Golgin_A5 NAGidase Crescentin HAD_SAK_1 ATG16 DUF1664
Other DBs
NCBI-GeneID: 83431
NCBI-ProteinID: NP_076157
MGI: 1932915
Ensembl: ENSMUSG00000018736
Vega: OTTMUSG00000005956
UniProt: Q9ERR1
Position
11; 11 B3
AA seq 345 aa
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENSFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYVPGSVNCGVMNSNG
PECPRSGRATFFHKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggatggtgaagatataccggatttttcaagtttaaaggaagaaactgcttattggaag
gaactttccttgaagtataagcaaagcttccaggaagctcgggatgagctagttgagttc
caggaaggaagcagagagttagaagcagagttggaggcacagttagtacaggctgaacaa
agaaatagagacctgcaggctgataaccaaagactgaagtatgaagtggaggcgttaaag
gagaaactagagcatcagtatgcacagagctacaagcaggtctcagtgttagaagatgat
ttaagtcagacccgggccattaaggagcaactgcataagtatgtgagagagctggagcag
gccaatgatgacctggagcgagcaaaaagggcaacaatagtttcactggaagactttgaa
caaaggctaaatcaggccattgaacgaaatgcattcttagaaagtgagctcgatgaaaag
gaatctttgttggtctcagtacagaggttaaaggatgaagccagagatttaaggcaagaa
ctagcagttcgggaacgacaacaggaagtgacccgcaagtctgcccccagctctccaact
ctggactgtgagaagatggattctgcggtccaggcttcactctccttgcctgcaacgcct
gttgggaaaggcacagaaaacagttttccttcaccaaaagctataccaaacggctttgga
accagtccactaactccttctgctaggatatcagcactaaacatcgtgggagatctcttg
cggaaagtaggggctttagaatccaagttagccgcttgcaggaactttgcaaaagaccaa
gcatcccgcaaatcttatgttccagggagcgttaactgtggggtaatgaacagcaatggc
ccagagtgcccaaggtcagggcgagcaactttcttccataaaggggcagtaaatggcttt
gatccagctcctcctcctcctgggctgggctcctcacgcccatcgtcagcaccgggtatg
ctgcctctcagtgtgtga

DBGET integrated database retrieval system