KEGG   Mus musculus (house mouse): 83436
Entry
83436             CDS       T01002                                 
Symbol
Plekha2, 6430512N22Rik, AI851530, AU041791, TAPP2, W91773
Name
(RefSeq) pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 2
  KO
K23796  pleckstrin homology domain-containing family A member 1/2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    83436 (Plekha2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   83436 (Plekha2)
SSDB
Motif
Pfam: PH PH_11 PH_8 PH_9 Mcp5_PH PH_13 PH_3
Other DBs
NCBI-GeneID: 83436
NCBI-ProteinID: NP_112547
MGI: 1928144
Ensembl: ENSMUSG00000031557
UniProt: Q9ERS5
Structure
Position
8:complement(25529160..25594686)
AA seq 425 aa
MPYVDRQNRICGFLDIEDNENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKAG
TVPLATEVLKNLTAPPTLEKKPQVAYKTEIIGGVVVQTPISQNGGDGQEGCEPGTHAFLR
RSQSYIPTSGCRPSTGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLR
TIPLKDVLKTHECLVKSGDLLMRDNLFEIITTSRTFYVQADSPEDMHSWIEGIGAAVQAL
KCHPREPSFSRSISLTRPGSSTLTSAPNSILSRRRPPAEEKRGLCKAPSVASSWQPWTPV
PQAEEKPLSVEHAPEDSLFMPNPGESTATGVLASSRVRHRSEPQHPKEKPFVFNLDDENI
RTSDV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgccttatgtggatcggcagaaccgaatctgtgggtttctggatattgaagacaatgag
aacagtggcaaattcctccggagatactttatcctggatacccaggccaactgcctcctc
tggtacatggacaatccccagaacctggccgttggggcaggagctgtcggatctctgcag
ctgacctacatctcgaaggtgagcatagctaccccaaagcagaaacctaaaacgccattc
tgcttcgttatcaatgccctgtctcagagatattttcttcaagccaatgaccagaaagat
ctgaaggactgggtagaagccttgaaccaagccagcaagatcactgtacccaaagctggg
acagtacccttggccacagaagttctcaaaaacttaacagctcctcccaccctagagaag
aagccgcaggtggcctacaagactgagatcatcgggggtgtggtggtacaaacgcctatc
agccagaacggtggggatgggcaggaagggtgcgagccagggactcacgccttcctgcga
aggtctcagagctacatccccacgtcaggctgccgcccttccactgggcctcccctcatt
aagagtggctactgtgtgaagcaagggaatgtgcggaagagttggaaacgacgcttcttt
gccctcgatgactttaccatctgctacttcaagtgtgagcaggacagagagcctctgcgt
accataccgctcaaggatgttctcaagactcacgagtgtctggtcaagtctggtgatctc
ttaatgagggacaacctgtttgaaatcataaccacctccaggacgttctacgtacaggcg
gacagccctgaggacatgcacagctggatcgaggggattggagcagctgtccaggctctg
aagtgccaccctagggagccgtccttttcaaggtccatttctttgactcgacctggaagt
tctacccttacaagcgcgcctaactccatcttgtcaagaaggcggccaccagcagaagag
aaaagaggtctctgtaaggccccttcggtggcctcctcctggcaaccctggacacctgtc
ccccaggctgaggaaaagccgttgtcggtggagcatgctccagaggactctctattcatg
cctaaccctggggagagcacagctacaggggtgctggcaagttctcgagtcaggcacagg
tcggagccccagcaccccaaggagaagccatttgtattcaaccttgatgacgaaaacata
cgaacctctgatgtgtga

DBGET integrated database retrieval system