KEGG   Mus musculus (mouse): 83490
Entry
83490             CDS       T01002                                 

Gene name
Pik3ap1, 1810044J04Rik, BCAP
Definition
(RefSeq) phosphoinositide-3-kinase adaptor protein 1
  KO
K12230  phosphoinositide 3-kinase adapter protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    83490 (Pik3ap1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    83490 (Pik3ap1)
SSDB
Motif
Pfam: DBB TIR_3
Other DBs
NCBI-GeneID: 83490
NCBI-ProteinID: NP_113553
MGI: 1933177
Ensembl: ENSMUSG00000025017
UniProt: Q9EQ32
Position
19; 19 C3
AA seq 811 aa
MAASGWGRGCDILIFYSPDAEEWCQYLQDLFVSCRQVRSQKTQTYRLVPDASFSAQDLWV
FRDARCVLVLLSAGLVGCFGQPGLLPMLQRACHPPQRVVRLLCGVQPGDEDFQAFFPDWA
HWQEMTCDDEPETYLAAVRKAISEDSGCDSVTDTEPEDERELPFSKQTNLPPEISPGNLM
VVQPDRIRCGAETTVYIIVRCKLDEKVSTEAEFSPEDSPSIRVEGTLENEYTVSVKAPDL
SSGNVSLKVYSGDLVVCETTVSYYTDMEEIGNLLSSAANPVEFMCQAFKIVPYNTETLDK
LLTESLKNNIPASGLHLFGINQLEEDDMMTNQRDEELPTLLHFAAKYGLKNLTALLLTCP
GALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKTHIKEELMQGEEADDVY
ESMAHLSTDLLMKCSLNPGCDDELYESMAAFAPAATEDLYVEMLQASAGNPVSGESFSRP
TKDSMIRKFLEGNSVKPASWEREQHHPYGEELYHIVDEDETFSVDLANRPPVPVPRPEAS
APGPPPPPDNEPYISKVFAEKSQERLGNFYVSSESIRKEPLVRPWRDRPPSSIYDPFAGM
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRESITRR
RKEKPKSGKHTDLEITVPIRHSQHLPEKVEFGVYESGPRKSVLPARTELRRGDWKTDSMS
STASSTSNRSSTRSLLSVSSGMEGDNEDNEIPEITRSRGPGPTQVDGAPVVTGTPVGTLE
RPPRVPPRAASQRPLTRESFHPPPPVPPRGR
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggcagcctcagggtggggccggggatgcgacatcctcatcttctacagcccagatgcg
gaggaatggtgtcagtacctacaggatcttttcgtgtcctgccggcaggttcgtagccag
aagacgcagacataccggctggtcccggatgcctctttctctgcccaggacctgtgggtc
ttcagggatgcgcgatgcgtgctggtgctactgtcggcggggctggtaggatgcttcggc
cagccaggactgctgccaatgctgcagcgtgcctgccatccgccgcagcgtgtggtgcgg
ctgttgtgtggagtgcagccaggcgacgaggacttccaggccttctttcctgactgggcc
cactggcaggaaatgacttgtgatgatgagccagagacctacctggcggctgtgaggaag
gccatttctgaagattctggctgtgactcagtaaccgacacggagcccgaggacgagaga
gagcttcctttctcaaagcagacaaacctgcctccggagatatcgcctgggaacctgatg
gtggtacagccggaccgcattcgctgtggggcagaaaccactgtgtatatcattgtgaga
tgcaagctggacgagaaggtatcaacagaagcagagttctctcctgaggattctccctcc
atccgggtggaaggcacactggagaatgagtacacggtctctgtgaaagcaccagacctc
tcctcggggaatgtttctctgaaggtctattctggggacctggtggtctgcgaaaccacc
gtcagctattataccgacatggaggaaattgggaacttactgtcgagtgctgcaaatcct
gtggagtttatgtgtcaggcctttaaaatcgtgccctacaacacagagactctcgataaa
ctgctcaccgagtccctgaagaacaacatccccgcaagtggactgcacctctttgggatc
aaccaactggaagaagacgatatgatgacaaatcagagggacgaagagctgcccacgctg
ttgcattttgctgccaagtatggactgaagaacctcactgccttgctgctcacctgtcca
ggggctctccaggcctacagtgtagccaacaagcacggccactatcccaacaccattgcc
gagaaacacggcttcagggacctgcgccagttcatcgacgagtatgtggagacggtggac
atgctgaagacacacattaaggaggagttgatgcaaggggaggaggcggacgatgtgtac
gagtccatggcccacctatccacagacctgctgatgaagtgctccctcaaccctggctgt
gacgatgagctctacgagtccatggctgccttcgccccagcagccacagaagacctctat
gttgaaatgcttcaggccagtgcaggtaacccagtctcgggagaaagtttctctcggccc
actaaagactcgatgatccgcaagtttctagaaggtaacagtgtgaaaccggccagttgg
gagagagaacaacaccatccctatggggaggaactttatcacattgtggatgaagatgag
accttctctgtggacctagccaacaggccccctgtccctgtgcccaggccagaggccagc
gctcctggccctcccccaccgcctgacaatgagccatacatttctaaagtttttgcagaa
aaaagtcaggagcggctcgggaatttctacgtttcttctgagagcatcagaaaagagcca
cttgtgaggccatggagggacaggccgccatcgagcatctacgacccatttgctggaatg
aagaccccgggccagcggcagctcatcaccctgcaggagcaggtgaagctgggcatcgtc
aacgtggacgaggccgtgctgcatttcaaagagtggcaactcaatcagaagaagcgatcc
gagtccttccgcttccagcaggaaaatcttaaaagactaagagagagcatcacccgaaga
cggaaagagaagccaaagtctgggaagcacacagacctggagatcacagtcccaatccga
cattcacagcacctgccagagaaagtggagtttggcgtgtatgagagcggccccaggaag
agtgtcttgccggccaggacagagctgagacgtggggactggaaaacggacagcatgtcc
agcacagcaagcagcacgagtaaccggtcgagcacacggagcctcctcagtgtgagcagt
ggaatggagggcgacaacgaggacaacgaaatccccgaaattacccggagtcgtggccca
ggtcctacgcaggtggacggagctccagttgtgaccggaacaccagtcgggacccttgag
agaccccctagggtgcctcctcgagccgcttctcagaggcctctaacccgggagtccttc
catcctcctccgccggttccacccagaggtcgctga

DBGET integrated database retrieval system