KEGG   Mus musculus (mouse): 83493Help
Entry
83493             CDS       T01002                                 

Gene name
Sacm1l, SAC1, Sac1p, mKIAA0851
Definition
(RefSeq) SAC1 suppressor of actin mutations 1-like (yeast)
  KO
K21797  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    83493 (Sacm1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    83493 (Sacm1l)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     83493 (Sacm1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syja_N
Motif
Other DBs
NCBI-GeneID: 83493
NCBI-ProteinID: NP_109617
MGI: 1933169
Ensembl: ENSMUSG00000025240
Vega: OTTMUSG00000062851
UniProt: Q9EP69
Position
9 F4; 9 74.08 cM
AA seq 587 aa AA seqDB search
MAAAAYEHLKLHITPEKFYVEACDDGADDVLIIDRVSTEVTLAVKKDVPPSAVTRPIFGI
LGTIHLVAGNYLVVITKKMKVGECFNHAVWRATDFDVLSYKKTMLHLTDIQLQDNKTFLA
MLNHVLSMDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP
EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET
EQIVHYSGNRASFVQTRGSIPIFWSQRPNLKYKPHPQISKVANHMDGFQRHFDSQVIIYG
KQVIINLVNHKGSEKPLEQTFANMVSSLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVA
EMQDELSYFLVDSAGKVVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV
GQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLLMDGFNSLLR
YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL
MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcagcctacgagcatctgaagctgcatattacacctgaaaagttttatgtg
gaggcttgtgatgatggagcagatgatgtactcatcattgaccgagtgtccacagaggtc
acccttgcagtcaaaaaagatgttcccccctctgctgttacaagaccaatatttgggata
ctgggcacaatccatctggtggcaggtaattatcttgttgtcatcaccaaaaagatgaaa
gtaggtgaatgttttaatcatgcggtctggagagccacagattttgatgttctttcttat
aagaagacaatgttgcacttgactgatattcagttacaagataataaaactttcctagca
atgctaaaccatgtcttgagtatggatggattttacttttcaacaacatatgacttgact
catactttgcagcgactatctaacacgagtccagaattccaagaaatgagtctcttagaa
agggcagatcagcggtttgtatggaacgggcatctgctcagggaactgtctgctcagcca
gaggtccatcggtttgctcttccagtgttgcatggctttattactatgcactcatgttct
attaatggaaaatattttgattggattctcatctcccgaaggagttgtttcagagctggt
gttcgttattatgtgagaggaattgattctgaaggccacgcagctaactttgtagaaaca
gagcagattgtgcactacagcgggaacagggcttcgtttgtccagactcgaggatcaata
cctattttctggtcacagagaccaaatctaaagtacaaaccacatccacagatcagcaaa
gtagcaaatcacatggatggtttccagaggcattttgattcacaagtaattatttatgga
aagcaagtaataattaatctggtgaaccacaagggatcagagaaaccacttgagcaaaca
ttcgcaaacatggtgtcctccttgggaagtgggatgatcagatatattgcctttgacttc
cataaggagtgtaaaaatatgagatgggatcgattgagtattttattggatcaagtagca
gaaatgcaggatgaattaagttattttttagtagactctgccggcaaggtggtgacaaac
caggacggagttttccgcagcaactgcatggattgtctagacagaacgaatgtgatacag
agtttattagctcgacgttcccttcaggcacagctgcagaggctaggagttttgcatgtg
ggacagaagcttgaagagcaagatgaatttgagaagacttacaaaaatgcctgggccgat
aatgctaatgcttgtgccaaacagtatgcgggaaccggtgccttgaagactgactttaca
agaactggaaaaagaactcagttgggactattaatggatggcttcaactcattattacgg
tattacaagaacaacttttctgatggatttagacaagattccatagacttatttcttgga
aattattcagtggatgaattagaatctcatagccctttaagtgttccaagggactggaaa
ttcctggcgttgcctatcatcatggttgttgccttttcaatgtgcatcatctgtttgctt
atggctggtgacacttggacagaaacactggcatatgtcctcttctggggagttgcaagc
attggaacattttttattattctttacaatggcaaagattttgttgatgctcccagactg
gtccagaaagaaaagatagactga

DBGET integrated database retrieval system