KEGG   Mus musculus (mouse): 83554
Entry
83554             CDS       T01002                                 

Gene name
Fstl3, E030038F23Rik, Flrg
Definition
(RefSeq) follistatin-like 3
  KO
K23913  follistatin-related protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    83554 (Fstl3)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I1: Kazal family
   83554 (Fstl3)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 FOLN
Other DBs
NCBI-GeneID: 83554
NCBI-ProteinID: NP_113557
MGI: 1890391
Ensembl: ENSMUSG00000020325
Vega: OTTMUSG00000035143
UniProt: Q9EQC7 Q542M9
Position
10; 10 C1
AA seq 256 aa
MRSGALWPLLWGALVWTVGSVGAVMGSEDSVPGGVCWLQQGREATCSLVLKTRVSREECC
ASGNINTAWSNFTHPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECV
PNCEGLPAGFQVCGSDGATYRDECELRTARCRGHPDLRVMYRGRCQKSCAQVVCPRPQSC
LVDQTGSAHCVVCRAAPCPVPSNPGQELCGNNNVTYISSCHLRQATCFLGRSIGVRHPGI
CTGGPKVPAEEEENFV
NT seq 771 nt   +upstreamnt  +downstreamnt
atgcgttctggggcactgtggccgctgctttggggagccctggtctggacagtgggatcc
gtgggcgccgtgatgggctccgaggattctgtgcccggtggcgtgtgctggctccagcag
ggcagagaggccacctgcagtctggtgctgaagactcgtgtcagccgggaggagtgctgt
gcttccggcaacatcaacaccgcctggtccaacttcacccacccaggcaataaaatcagc
ctgctagggttcctgggcctcgtccactgcctcccctgcaaagattcctgcgacggagtg
gagtgcggccccggcaaggcgtgccgcatgctggggggccgtccacactgcgagtgcgtg
cccaactgcgaggggcttcccgcgggcttccaggtctgcggctctgatggcgccacctac
cgggacgaatgcgaactgcgcaccgcgcgctgtcgcggacacccagacttgcgcgtcatg
taccgcggccgctgtcaaaagtcttgcgctcaggtagtgtgcccgcgtccccagtcgtgc
cttgtggatcagaccggcagcgcacactgcgtggtgtgtcgcgctgcgccctgcccagta
ccttccaaccccggccaagaactctgtggcaacaacaacgttacctacatctcgtcgtgt
cacctgcgccaggccacttgcttcctgggccgctccattggggttcggcacccaggcatc
tgcacaggtggccccaaagtaccagcagaggaggaagagaacttcgtgtga

DBGET integrated database retrieval system