KEGG   Mus musculus (house mouse): 83560
Entry
83560             CDS       T01002                                 
Symbol
Tex14
Name
(RefSeq) testis expressed gene 14
  KO
K17540  inactive serine/threonine-protein kinase TEX14
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    83560 (Tex14)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    83560 (Tex14)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NKF5 family
   83560 (Tex14)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   83560 (Tex14)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ank_2 Ank_4 Ank_3 Ank_5 Ead_Ea22
Other DBs
NCBI-GeneID: 83560
NCBI-ProteinID: NP_113563
MGI: 1933227
Ensembl: ENSMUSG00000010342
UniProt: Q7M6U3
Position
11:87295839..87446649
AA seq 1450 aa
MSRGAPFPVPCPVLLGTFTDDSLEAQLHEYAKQGNCVKLKKILKKGVCVDAVNTQGQSAL
FVAALLGHVKLVDVLVDYGSDPNHRCFDGSTPVHAAAFSGNQWILSKLLTAGGDLRLHDE
KGRNPQAWALTAGKDRSTQMVEFMQRCTSHMKAIIQGFSYDLLKKIDSPQRLIGSPPWFG
SLIQGSPNSSPNRQLKPGIISAQNIYSFGFGKFYLTSGMQLTYPGSLPVIGEKEVVQADD
EPTFSFFSGPYMVMTNLVWNRSRVTVKELNLPTRPHCSRLRLADLLIAEQEHSSNLRHPN
LLQLMAVCLSRDLEKIRLVYERITVGTLFSVLHERRSQFPVLHMEVIVHLLLQVADALIY
LHSRGFIHRSLSSYAVHIVSAGEARLTNLEYLTESQDSGAHRNVTRMPLPTQLYNWAAPE
VVLQKAATVKSDIYSFSVIIQEILTDSIPWNGLDGSLVKETIALGNYLEADVRLPEPYYD
IVKSGIHAKQKNRTMNLQDIRYILKNDLKEFIGAQKTQPTESPRGQSYEPHPDVNICLGL
TSEYQKDPPDLDIKELKEMGSQPHSPTDHSFLTVKPTLAPQTLDSSLSAQKPDNANVPSP
PAACLAEEVRSPTASQDSLCSFEINEIYSGCLTLGTDKEEECLGTAASPEGDRPNQGDEL
PSLEEELDKMERELHCFCEEDKSISEVDTDLLFEDDDWQSDSLGSLNLPEPTREAKGKTS
SWSKTDEYVSKCVLNLKISQVMMQQSAEWLRKLEQEVEELEWAQKELDSQCSSLRDASLK
FANAKFQPAVGPPSLAYLPPVMQLPGLKQPENGGTWLTLARSPGNEREFQEGHFSKKPEK
LSACGWKPFTQVSEESRGDCSELNNQLPTLRGPGKQSTGEQLPSTQEARESLEKNTNQNS
RSMASVSSEIYATKSRNNEDNGEAHLKWRLAVKEMAEKAVSGQLLLPPWNPQSSAPFESK
VENESTPLPRPPIRGPESTEWQHILEYQRENDEPKGNTKFGKMDNSDCDKNKHSRWTGLQ
RFTGIRYPFFRNHEQPEQNEASQASCDTSVGTEKFYSTSSPIGDDFERFQDSFAQRQGYV
EENFQIREIFEKNAEILTKPQFQAIQCAEDKQDETLGETPKELKEKNTSLTDIQDLSSIT
YDQDGYFKETSYKTPKLKHAPTSASTPLSPESISSAASHYEDCLENTTFHVKRGSTFCWN
GQEAMRTLSAKFTTVRERAKSLESLLASSKSLPAKLTDSKRLCMLSETGSSNVSAAFVTS
THATKRKSLPRELAEATSQQHLDELPPPAQELLDEIEQLKQQQVSSLASHENTARDLSVT
NKDKKHLEEQETNSSKDSSFLSSREIQDLEDTERAHSSLDEDLERFLQSPEENTALLDPT
KGSTREKKNKDQDVVEQKRKKKESIKPERRESDSSLGTLEEDELKPCFWKRLGWSEPSRI
IVLDQSDLSD
NT seq 4353 nt   +upstreamnt  +downstreamnt
atgtctcggggggctccttttccagtcccttgcccggtgctgctggggaccttcacagat
gactccctggaggctcagcttcacgaatacgccaagcaagggaactgcgtgaagctcaag
aagattcttaagaagggagtctgtgtcgatgcagttaacactcagggccagtcagcgctc
tttgttgcagcattactgggccatgtgaaattagtggatgttctggtggattatggatca
gatccaaatcaccgctgctttgacgggagcactcctgtccatgcagcagccttttcaggc
aaccagtggatcctcagtaaactgctgactgcagggggtgacctgcgactccatgatgag
aagggtcggaatccacaggcctgggccttgacagcagggaaggatcgtagcactcagatg
gtggagttcatgcaacgttgtacttcacatatgaaggctatcatccagggcttctcctat
gaccttctgaagaagatagactctcctcagcgactcatcggcagcccaccctggtttggt
agcctcattcagggaagcccaaatagttctcccaaccgacagcttaaacctggaatcatt
tctgcccaaaatatctacagctttggctttgggaagttttatctcacctcagggatgcag
cttacttacccaggatctcttccagtcattggagagaaggaagtggtccaggctgatgat
gagcccaccttctctttcttcagtggcccctacatggtcatgactaacctcgtgtggaat
aggagcagagtcacagtaaaggagctgaaccttcccacccgtccccactgtagcaggctg
aggttggccgacttgctgattgctgagcaggagcacagcagcaacctgcggcatcctaac
ctgctgcaactgatggctgtatgtttgtcccgggacctggagaaaattcgcctggtttac
gagcgtatcacagtcggcacactgttcagtgtcctccatgaacgaaggtcccagttccca
gtgctgcacatggaggtgattgtgcacctgttgctccaggttgctgatgccttgatatac
ctgcattcccgggggttcatccaccgctccctcagctcctacgctgtccacatcgtctct
gcaggagaagcaaggctgactaacctggaatacctgacggaaagccaggacagtggtgca
cacaggaacgtgactcgaatgcccctccccacccagctgtacaactgggctgcaccagaa
gtggtcttgcagaaggcagccacggtgaagtcagacatatacagcttttccgtgatcata
caagagatcttaacagacagtataccctggaatggcttggatggctcacttgttaaagaa
accatagccttgggaaattatttagaagctgatgtcaggcttccggaaccttactatgat
attgttaagtcaggaatccatgccaagcagaagaaccgaacaatgaaccttcaagatatt
cgttatattctgaagaatgacttaaaggaatttattggagctcagaaaactcagccaacc
gagagccccagagggcagagctatgaaccccatcctgatgttaatatctgcctaggtcta
acttcagaatatcaaaaggaccctccagacttggacatcaaggaactaaaggaaatgggt
agtcagccccattcacctacagatcactcctttctcactgtaaaaccaacactagctcct
cagaccctagattcaagtctgtcagcccagaaacctgacaatgcaaatgttccttctcct
cctgctgcatgtctggcagaagaggtcaggagccccactgcaagtcaggacagcctctgc
agctttgaaatcaatgagatctactcaggctgcttgacactgggaactgacaaggaggaa
gagtgtctggggactgctgcttcacctgagggggatagaccaaaccagggagatgagctg
ccatccctggaagaagagctcgataagatggagagagaattgcactgtttttgtgaagag
gacaaaagcatttcagaagttgacacagaccttctttttgaggatgatgactggcaaagt
gattctcttggttcactcaacctgcccgaaccaaccagagaagccaagggcaaaacgagc
agctggtccaagactgatgagtatgtcagtaagtgtgtgctgaatctgaagatttcacag
gtgatgatgcagcagagcgctgagtggctgaggaagcttgagcaggaggtagaggagctc
gagtgggcacagaaggagctggacagtcagtgcagcagtttgcgggatgcttcattaaag
tttgcaaatgccaagttccagccggctgtaggccctccatctttggcctatcttcctcct
gttatgcaattaccagggctcaagcagcctgaaaatggtggcacctggttaaccctagca
aggtctccaggaaatgagagagagttccaagagggacattttagcaaaaaacctgagaaa
ctaagtgcctgtggctggaagccttttacacaagtgtctgaagaaagcagaggggactgc
tcagagctaaacaatcagctgccgactcttcgtggtcctgggaagcagagcacaggtgag
cagttaccatccactcaagaagcaagggagagtttggaaaaaaatacaaaccaaaatagt
aggagtatggcgtctgtgtcttctgaaatctatgctactaagtcaagaaataatgaggat
aatggagaggcacacttgaaatggagattggcagtaaaagaaatggcagagaaagcagtt
tccggacagctcttattacctccttggaatcctcagagtagtgcgccttttgagagtaag
gttgaaaatgagagcactcctttgccacggcccccaattagaggtcctgagagcacagaa
tggcagcacattttagaataccagagggaaaatgatgagcccaaaggaaatacgaagttt
ggcaaaatggacaacagtgactgtgacaagaacaagcacagcagatggacaggcctccag
cgcttcactggtattagatacccattcttcagaaaccacgagcagccagagcagaatgaa
gcctctcaagcaagctgtgacacgtctgtgggcactgagaagttctacagcacctcaagt
cccataggagacgactttgaaagattccaagattcttttgcccaacgtcaaggctatgtt
gaagaaaatttccaaataagagaaatatttgaaaagaatgctgagattttgaccaagcct
cagtttcaagctattcaatgtgctgaagacaaacaagacgaaacattaggggagacgcca
aaggaactgaaagagaaaaacacatcactgacagacattcaagacttgtccagcatcacc
tatgatcaagacggctattttaaggaaacctcatacaaaacacccaaattaaaacacgca
ccaactagtgccagtaccccgctaagcccagagtcgatttcttcagctgctagtcactat
gaagactgccttgaaaataccacatttcatgttaaaagaggatctacattttgttggaat
ggccaagaagctatgagaactttgtctgccaaatttacaactgtccgagagagagctaag
agcctggaatcacttctcgcttcttctaaaagcctacctgccaagctgactgactccaag
agattgtgtatgttgagtgagactggctcttctaacgtttctgcggcatttgtaacatca
actcatgctaccaagaggaagagcctacccagagaactggcagaagccacctctcaacag
catcttgatgagcttccaccaccagctcaggagctacttgatgaaattgagcaactgaag
cagcagcaggtctcatccctggcgtcacatgagaacacggcacgtgatctgagtgtcact
aacaaggataagaagcatttggaagaacaagaaaccaacagtagtaaagacagcagtttt
ctttccagcagagaaattcaggatctggaagatacagagagagctcattcttctcttgat
gaggacctggaaagattcctgcagtcacctgaggagaacacggcactgctggaccctacc
aagggctctacaagggagaaaaaaaacaaagatcaagacgttgttgagcagaagagaaaa
aagaaagaaagcatcaagccagagagaagggagtcagacagctccctagggaccttggaa
gaagatgaactaaaaccctgtttttggaagcgactgggttggtccgaaccttccaggata
attgtgctggatcagagcgacttgtcagactga

DBGET integrated database retrieval system