KEGG   Mus musculus (mouse): 83561
Entry
83561             CDS       T01002                                 

Gene name
Tdrd1, MTR-1
Definition
(RefSeq) tudor domain containing 1
  KO
K18405  tudor domain-containing protein 1/4/6/7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    83561 (Tdrd1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    83561 (Tdrd1)
SSDB
Motif
Pfam: TUDOR SMN zf-MYND
Other DBs
NCBI-GeneID: 83561
NCBI-ProteinID: NP_001002238
MGI: 1933218
Ensembl: ENSMUSG00000025081
Vega: OTTMUSG00000028359
UniProt: Q99MV1
Structure
PDB: 
4B9W 4B9X

Position
19; 19 D2
AA seq 1172 aa
MMPRNNLEASTCKMAEPFNFEKKESKPPPQDPLRSPVAQHNHPTFRLKSPENGNTKNNFL
LCEQNKQYLASQEDSSVVSSNPAVVNGEVGGSKGDRKPPPTGNPVSPLSLGNSSPPNQVK
TKPSSNVTPEKSKKSHKLFENALSVNNPALFNSLGPPLRSTTCHRCGLFGSLRCSQCKQT
YYCSTACQRRDWSSHSTICRPVQQSLNKLEDNKSPFETKAIEVKSEVDCPPGVTKEITAG
AERVMFSDLRSLQLKKTMEIKGTVTEFKHPSNFYIQLYSSEVLENMNQLSTSLKETYANV
VPEDGYLPVKGEVCVAKYTVDQTWNRAIVQAVDVLQRKAHVLYIDYGNEEMIPIDSVHPL
SRGLDLFPPSAIKCCVSGVIPTAGEWSEGCVAAVKALLFEQFCSVKVMDILEEEVLTCAV
DLVLQSSGKQLDHVLVEMGYGVKPGEQSSTEQSVDHSALEDVGRVTVESKIVTDRNALIP
KVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGHKLAELQESLSEYCGHVIPRSDFYPTIG
DVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQAL
NCVLAGVKPSLGIWTPEAVCVMKEMVQNRMVTVRVVGMLGTRALVELIDKSVAPHVSASK
ALIDSGFAIKEKDVADKGSSMHTASVPLAIEGPAEALEWTWVEFTVDETVDVVVCMMYSP
GEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKE
ILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATA
RFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCGSPQDSLMS
RPANQHKQIDSHRVQASPSAEQWKTMELPVNKTIAANVLEIISPALFYAIPSEMSENQEK
LCVLAAELLEHCNAQKGQPAYRPRTGDACCAKYTNDDFWYRAIVLETSESDVKVLYADYG
NIETLPLSRVQPIPASHLELPFQIIRCSLEGPMELNGSCSQLVMELLRNAMLNQSVVLSV
KAISKNVHAVSVEKCSENGMINIAENLVMCGLAENLTSKRKSASTKEIPHSRDCCCTELQ
KQIEKHEQILLFLLNNPTNQSKFTEMKKLLRS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgatgccacggaataatttggaagcctctacttgtaaaatggcagagccatttaatttt
gagaagaaggaaagcaagcccccgccccaggaccctctcagaagtcctgtagcacagcat
aaccaccccaccttcaggctgaaaagcccagagaacgggaatacaaagaacaactttttg
ctttgtgaacaaaacaaacagtatttagctagtcaggaggacagttcggtggtctcttca
aaccctgctgttgtcaatggagaagtcggtgggtccaaaggagacaggaagccgccacca
acaggaaacccagtgtcaccattaagtcttggaaacagttcacctcctaaccaagtaaaa
actaagcccagcagtaatgtgactcctgaaaaatcaaaaaaatctcacaagttgtttgag
aatgccttgtccgtaaataatccagcactcttcaactcgttaggaccgccccttcggtca
acaacctgccaccgctgtggcctgtttgggtcgctgaggtgctcccagtgcaagcagacg
tactactgctccacggcctgccagaggagagactggtcttcccacagcaccatctgtagg
cctgtacagcaaagtttgaacaagcttgaagataataaatcaccatttgaaacaaaggcc
attgaagtgaagagtgaggttgactgtcccccgggagttactaaagaaataacagcgggt
gctgagagagtaatgttctctgatttgagaagtctccaactcaagaaaaccatggagata
aagggtacagttactgaattcaagcacccgagtaacttttatatccagttgtattcttca
gaggttctagaaaacatgaaccaactctctacaagcttgaaagagacatatgcaaatgtg
gtgcctgaagatggttatcttcctgttaagggggaagtttgtgttgccaaatacacagtt
gatcagacctggaacagagccatagtacaagccgtggatgtgctgcagaggaaggcccac
gtcctgtacattgactatgggaacgaggagatgatcccgatagacagcgttcacccgctg
agcagaggccttgacttgtttcctccttctgccataaagtgctgtgtgtcaggcgtcatt
cccactgcgggcgagtggagtgaaggctgtgttgcagctgtcaaggcccttctgtttgag
cagttctgctctgtcaaggtcatggacatcttagaggaggaggtactcacctgtgccgtt
gaccttgttctacagagctcaggaaagcagctggaccatgtgctggtggaaatggggtat
ggagtgaaacccggtgagcagagctccacggagcagagtgtggaccacagtgcattggag
gacgttggaagagtgacagttgagagcaagattgtgacagacagaaatgccctgatcccc
aaagtgctgactttgaatgtgggtgatgagttctgtggcgtggttgcccacatccagaca
ccagaggacttcttttgtcagcagctgcagagcggccacaagcttgcggagcttcaggaa
tccctcagtgaatactgtggccatgtgattccacgctctgacttttatccaaccattggg
gacgtgtgctgtgctcagttctcagaggatgatcagtggtaccgcgcctcggttctggcc
tacgcttctgaagaatctgtcctggttggatatgtcgattatgggaactttgagattctc
agtctgaaaagactttgtcccataattccaaagttgttggatttgccgatgcaagctcta
aattgtgtgctggcaggcgtgaagccatcattaggaatttggactccagaagctgtgtgt
gtcatgaaagagatggtacagaacaggatggtcacagtgagagtggtgggcatgctgggg
accagggccctggtggagctcatcgacaagtcggtggctcctcacgtcagcgcttctaaa
gctctcatagactcgggctttgccatcaaagaaaaggacgtggcagataaaggcagcagt
atgcacacagccagtgttcccttggccattgaaggtccagcagaggcgttggagtggacg
tgggtggagttcactgttgacgagaccgtggatgtggtggtctgcatgatgtacagtccc
ggggagttctactgccactttcttaaagatgatgccttagagaagctcgatgacttgaat
cagtccttagcagactactgtgcacaaaagccgcccaatggctttaaggcagagataggg
cggccttgctgtgcctttttttcaggtgacggcaactggtaccgggctctagtcaaggag
atcttaccaagtgggaatgttaaagtccactttgtggattacggaaatgttgaagaagtt
accacagaccaactccaggcgatattaccacagttcttactacttccatttcaggggatg
cagtgctggctagtagatatacagcccccaaacaagcattggacaaaagaggccacagca
agatttcaagcatgtgttgtggggctcaaactccaagccagagttgtggaaatcaccgcg
aacggcgtgggcgtggagctcaccgatctttccactccttaccccaaaatcattagtgat
gtgctcatcagagagcagttggtcttaaggtgtggttcaccacaggactcactgatgagc
agacctgctaatcaacataagcagatcgacagccacagggtgcaagccagcccttcagca
gagcagtggaagacaatggaattgccagttaacaagactatagcagcaaatgtactagag
atcataagcccagccttgttctacgccatccccagtgaaatgtcagaaaatcaagagaag
ctgtgtgtgttagcagctgaattgttagaacactgtaatgctcagaagggccagccagcc
tacagaccacggaccggcgacgcgtgctgtgctaagtacacaaatgatgacttctggtac
cgggccattgttctggaaacgtcggaatctgatgtgaaagttctctacgcagattatgga
aacatcgaaaccctgcctctttccagagtgcagcccatcccagccagccacctggagctg
cccttccagatcattagatgctcactagaggggccgatggagctgaatggaagctgttcg
cagttagtgatggagctgctgagaaatgccatgctgaaccagagtgtggttctctctgtg
aaagccatttcaaagaatgtccacgcagtgtcagttgaaaaatgttctgagaacggaatg
atcaatatagctgagaatctggtgatgtgtggcctggcagaaaacctcacttctaaaagg
aaaagtgcttccactaaagagataccacacagcagagactgctgttgcacagagttacag
aaacagattgagaaacacgaacagattctcctcttcctcttaaacaatccaaccaaccaa
agtaaattcacagagatgaaaaagctgctgagaagctaa

DBGET integrated database retrieval system