KEGG   Mus musculus (house mouse): 83762
Entry
83762             CDS       T01002                                 
Symbol
Otof
Name
(RefSeq) otoferlin
  KO
K19949  otoferlin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    83762 (Otof)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    83762 (Otof)
SSDB
Motif
Pfam: C2 Ferlin_C FerB FerI GemA
Other DBs
NCBI-GeneID: 83762
NCBI-ProteinID: NP_114081
MGI: 1891247
Ensembl: ENSMUSG00000062372
UniProt: Q9ESF1 E9PYR6
Position
5:complement(30524410..30620073)
AA seq 1997 aa
MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNE
VLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRYQA
TDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISGEKSFRRAGRSVFSAMKL
GKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSLASVTALTSNVSNKRSKPD
IKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYF
VFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSD
PDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVPPERQWARFYV
KIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQ
VVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYG
STRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSE
SCTGRMEEFFLFGAFLEASMIDRKNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGD
EEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQ
RRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKD
QGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADE
PQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGS
AGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQ
LRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGE
AHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRG
SATAGDLLAAFELLQIGPSGKADLPPINGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFWG
LRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPP
LNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPDRSAPNWNTTVRLLRGCHRLRNGGPSS
RPTGEVVVSMEPEEPVKKLETMVKLDATSDAVVKVDVAEDEKERKKKKKKGPSEEPEEEE
PDESMLDWWSKYFASIDTMKEQLRQHETSGTDLEEKEEMESAEGLKGPMKSKEKSRAAKE
EKKKKNQSPGPGQGSEAPEKKKAKIDELKVYPKELESEFDSFEDWLHTFNLLRGKTGDDE
DGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVR
ATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVA
VYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLC
KEGKVDGPHFGPHGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCR
LVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWN
TDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYL
AAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKT
AKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAE
KNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFA
LFLYSLPGYLAKKILGA
NT seq 5994 nt   +upstreamnt  +downstreamnt
atggccctgattgttcacctcaagactgtctcagagctccgaggcaaaggtgaccggatt
gccaaagtcactttccgagggcagtctttctactcccgggtcctggagaactgcgagggt
gtggctgactttgatgagacgttccggtggccagtggccagcagcatcgaccggaatgaa
gtgttggagattcagattttcaactacagcaaagtcttcagcaacaagctgatagggacc
ttctgcatggtgctgcagaaagtggtggaggagaatcgggtagaggtgaccgacacgctg
atggatgacagcaatgctatcatcaagaccagcctgagcatggaggtccggtatcaggcc
acagatggcactgtgggcccctgggatgatggagacttcctgggagatgaatccctccag
gaggagaaggacagccaggagacagatgggctgctacctggttcccgacccagcacccgg
atatctggcgagaagagctttcgcagagcgggaaggagtgtgttctcggccatgaaactc
ggcaaaactcggtcccacaaagaggagccccaaagacaagatgagccagcagtgctggag
atggaggacctggaccacctagccattcagctgggggatgggctggatcctgactccgtg
tctctagcctcggtcaccgctctcaccagcaatgtctccaacaaacggtctaagccagat
attaagatggagcccagtgctggaaggcccatggattaccaggtcagcatcacagtgatt
gaggctcggcagctggtgggcttgaacatggaccctgtggtgtgtgtggaggtgggtgat
gacaagaaatacacgtcaatgaaggagtccacaaactgcccttactacaacgagtacttt
gtcttcgacttccatgtctctcctgatgtcatgtttgacaagatcatcaagatctcggtt
atccattctaagaacctgcttcggagcggcaccctggtgggttccttcaaaatggatgtg
gggactgtgtattcccagcctgaacaccagttccatcacaaatgggccatcctgtcagac
cccgatgacatctctgctgggttgaagggttatgtaaagtgtgatgtcgctgtggtgggc
aagggagacaacatcaagacaccccacaaggccaacgagacggatgaggacgacattgaa
gggaacttgctgctccccgagggcgtgccccccgaacggcagtgggcacggttctatgtg
aaaatttaccgagcagagggactgccccggatgaacacaagcctcatggccaacgtgaag
aaggcgttcatcggtgagaacaaggacctcgtcgacccctatgtgcaagtcttctttgct
ggacaaaagggcaaaacatcagtgcagaagagcagctatgagccgctatggaatgagcag
gtcgtcttcacagacttgttccccccactctgcaaacgcatgaaggtgcagatccgggac
tctgacaaggtcaatgatgtggccatcggcacccacttcatcgacctgcgcaagatttcc
aacgatggagacaaaggcttcctgcctaccctcggtccagcctgggtgaacatgtacggc
tccacgcgcaactacacactgctggacgagcaccaggacttgaatgaaggcctgggggag
ggtgtgtccttccgggcccgcctcatgttgggactagctgtggagatcctggacacctcc
aacccagagctcaccagctccacggaggtgcaggtggagcaggccacgcctgtctcggag
agctgcacagggagaatggaagaattttttctatttggagccttcttggaagcctcaatg
attgaccggaaaaatggggacaagccaattacctttgaggtgaccataggaaactacggc
aatgaagtcgatggtatgtcccggcccctgaggcctcggccccggaaagagcctggggat
gaagaagaggtagacctgattcagaactccagtgacgatgaaggtgacgaagccggggac
ctggcctcggtgtcctccaccccacctatgcggccccagatcacggacaggaactatttc
cacctgccctacctggagcgcaagccctgcatctatatcaagagctggtggcctgaccag
aggcggcgcctctacaatgccaacatcatggatcacattgctgacaagctggaagaaggc
ctgaatgatgtacaggagatgatcaaaacggagaagtcctacccggagcgccgcctgcgg
ggtgtgctagaggaactcagctgtggctgccaccgcttcctctccctctcggacaaggac
cagggccgctcgtcccgcaccaggctggatcgagagcgtcttaagtcctgtatgagggag
ttggagagcatgggacagcaggccaagagcctgagggctcaggtgaagcggcacactgtt
cgggacaagctgaggtcatgccagaactttctgcagaagctacgcttcctggcggatgag
ccccagcacagcattcctgatgtgttcatttggatgatgagcaacaacaaacgtatcgcc
tatgcccgcgtgccttccaaagacctgctcttctccatcgtggaggaggaactgggcaag
gactgcgccaaagtcaagaccctcttcctgaagctgccagggaagaggggcttcggctcg
gcaggctggacagtacaggccaagctggagctctacctgtggctgggcctcagcaagcag
cgaaaggacttcctgtgtggtctgccctgtggcttcgaggaggtcaaggcagcccaaggc
ctgggcctgcattcctttccgcccatcagcctagtctacaccaagaagcaagccttccag
ctccgagcacacatgtatcaggcccgaagcctctttgctgctgacagcagtgggctctct
gatccctttgcccgtgtcttcttcatcaaccagagccaatgcactgaggttctaaacgag
acactgtgtcccacctgggaccagatgctggtatttgacaacctggagctgtacggtgaa
gctcacgagttacgagatgatccccccatcattgtcattgaaatctacgaccaggacagc
atgggcaaagccgacttcatgggccggaccttcgccaagcccctggtgaagatggcagat
gaagcatactgcccacctcgcttcccgccgcagcttgagtactaccagatctaccgaggc
agtgccactgccggagacctactggctgccttcgagctgctgcagattgggccatcaggg
aaggctgacctgccacccatcaatggcccagtggacatggacagagggcccatcatgcct
gtgcccgtgggaatccggccagtgctcagcaagtaccgagtggaggtgctgttctggggc
ctgagggacctaaagagggtgaacctggcccaggtggaccgaccacgggtggacatcgag
tgtgcaggaaagggggtacaatcctccctgattcacaattataagaagaaccccaacttc
aacacgctggtcaagtggtttgaagtggacctcccggagaatgagctcctgcacccaccc
ttgaacatccgagtggtagattgccgggcctttggacgatacaccctggtgggttcccac
gcagtcagctcactgaggcgcttcatctaccgacctccagaccgctcagcccccaactgg
aacaccacagtcaggctgctccggggctgccacaggctgcgcaatgggggcccctcttct
cgccccacaggggaggttgtagtaagcatggagcctgaggagccagttaagaagctggag
accatggtgaaactggatgcgacttctgatgctgtggtcaaggtggatgtggctgaagat
gagaaggaaaggaagaagaagaaaaagaaaggcccgtcagaggagccagaggaggaagag
cccgatgagagcatgctggattggtggtccaagtacttcgcctccatcgacacaatgaag
gagcaacttcgacaacatgagacctctggaactgacttggaagagaaggaagagatggaa
agcgctgagggcctgaagggaccaatgaagagcaaggagaagtccagagctgcaaaggag
gagaaaaagaagaaaaaccagagccctggccctggccagggatcggaggctcctgagaag
aagaaagccaagatcgatgagcttaaggtgtaccccaaggagctggaatcggagtttgac
agctttgaggactggctgcacaccttcaacctgttgaggggcaagacgggagatgatgag
gatggctccacagaggaggagcgcatagtaggccgattcaagggctccctctgtgtgtac
aaagtgccactcccagaagatgtatctcgagaagctggctatgatcccacctatggaatg
ttccagggcatcccaagcaatgaccccatcaatgtgctggtccgaatctatgtggtccgg
gccacagacctgcacccggccgacatcaatggcaaagctgacccctatattgccatcaag
ttaggcaagaccgacatccgagacaaggagaactacatctccaagcagctcaaccctgtg
tttgggaagtcctttgacattgaggcctccttccccatggagtccatgttgacagtggcc
gtgtacgactgggatctggtgggcactgatgacctcatcggagaaaccaagattgacctg
gaaaaccgcttctacagcaagcatcgcgccacctgcggcatcgcacagacctattccata
catggctacaatatctggagggaccccatgaagcccagccagatcctgacacgcctctgt
aaagagggcaaagtggacggcccccactttggtccccatgggagagtgagggttgccaac
cgtgtcttcacggggccttcagaaatagaggatgagaatggtcagaggaagcccacagat
gagcacgtggcactgtctgctctgagacactgggaggacatcccccgggtgggctgccgc
cttgtgccggaacacgtggagaccaggccgctgctcaaccctgacaagccaggcattgag
cagggccgcctggagctgtgggtggacatgttccccatggacatgccagcccctgggaca
cctctggatatatcccccaggaaacccaagaagtacgagctgcgggtcatcgtgtggaac
acagacgaggtggtcctggaagacgatgatttcttcacgggagagaagtccagtgacatt
tttgtgagggggtggctgaagggccagcaggaggacaaacaggacacagatgtccactat
cactccctcacgggggagggcaacttcaactggagatacctcttccccttcgactaccta
gcggccgaagagaagatcgttatgtccaaaaaggagtctatgttctcctgggatgagacg
gagtacaagatccctgcgcggctcaccctgcagatctgggacgctgaccacttctcggct
gacgacttcctgggggctatcgagctggacctgaaccggttcccgaggggcgctaagaca
gccaagcagtgcaccatggagatggccaccggggaggtggacgtacccctggtttccatc
tttaaacagaaacgtgtcaaaggctggtggcccctcctggcccgcaatgagaatgatgag
tttgagctcacaggcaaagtggaggcggagctacacctactcacggcagaggaggcagag
aagaaccctgtgggcctggctcgcaatgaacctgatcccctagaaaaacccaatcggccg
gacacaagcttcatctggttcttgaaccctctcaagtctgcccgctacttcctgtggcat
acctaccgctggctactcctcaaattcctgctgctcttcctcctgctgctgctcttcgcc
ctgtttctctactctctgcctggctacctggccaagaagatccttggggcctga

DBGET integrated database retrieval system