KEGG   Mus musculus (mouse): 83767
Entry
83767             CDS       T01002                                 

Gene name
Wasf1, AI195380, AI838537, S, Scar, WA, WAVE, WAVE-1
Definition
(RefSeq) WASP family, member 1
  KO
K05753  WAS protein family, member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    83767 (Wasf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    83767 (Wasf1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    83767 (Wasf1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    83767 (Wasf1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    83767 (Wasf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    83767 (Wasf1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     83767 (Wasf1)
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 83767
NCBI-ProteinID: NP_114083
MGI: 1890563
Ensembl: ENSMUSG00000019831
Vega: OTTMUSG00000020871
UniProt: Q8R5H6
Position
10 B1; 10 22.07 cM
AA seq 559 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDADLLHKHIEVANGPASHYETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPTPTCISSA
TGLIENRPQSPAAGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVAVAALAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccgttggtgaaaagaaacatcgaccctcggcacttgtgccacacagcactgcccagg
ggcattaagaacgaactggaatgtgtaaccaacatttccctggcaaatataattagacaa
ctgagtagcctaagtaagtatgctgaagacatatttggagaattattcaatgaagcacac
agtttttccttcagagttaactcgttgcaagagcgcgtggaccgattgtctgttagtgtc
acacagcttgatcctaaggaggaagaactgtctttgcaagatataacgatgagaaaggct
ttccggagctccacaattcaagatcagcagcttttcgaccgcaagacgttgcctattcca
ttgcaagaaacatacgatgtgtgtgagcaacctccgcctctcaatatcctcaccccttac
agggatgatggtaaggaagggctgaagttttataccaatccttcatatttctttgatctg
tggaaagaaaagatgttgcaagatacagaggacaagaggaaggaaaagagaaagcagaag
cagaaaaatctagaccgtcctcatgaaccagagaaagtgccaagagcacctcatgacagg
cggcgggaatggcagaagctggcccaaggtccagagctggctgaggatgacgctgacctc
ctacacaagcatattgaagttgccaatggcccagcctctcattatgagacaaggccacag
acatacgtggatcatatggacggatcgtactcactctctgccttgccattcagtcagatg
agtgaacttctgaccagagctgaggagagggtcttagtcagaccccatgaacctcctccg
cctccaccaatgcatggagcaggagatgcaaagcccacacccacctgtatcagttctgct
acaggtttgatagagaatcgcccccagtccccagctgcaggcagaacacctgtgtttgtg
agccccactcccccacctcctcccccacctcttccgtctgccttgtccacttcttcacta
agagcttcaatgacctcaactcctcccccaccagtccctcctccgcctcctcccccagcc
actgctttgcaggccccagcagtgcccccacctccggctcctcttcagattgcccctggt
gttcttcacccagctcctcctccaattgctcctcctctagtgcagccctctcccccagta
gctcgagctgccccagtatgcgagactgtgccagttcacccactcccgcaaggtgaagtg
caggggctgcctccacccccaccaccgcctcctctacctccgcctggcatccggccatca
tctcctgtcgcagttgcagctcttgctcatcctccctctgggctccatccagcaccatct
actgccccgggtccccatgctccattaatgcctccatctcctccatcacaagttctacct
gcctctgagccaaagcgccatccatccaccctgcctgtaatcagtgacgcaaggagtgtg
ctgctggaagccatccgaaaaggtattcagcttcgcaaagtggaagagcagcgtgaacag
gaagcaaaacacgagcggattgaaaacgacgtggccaccatcctgtctcgccgcattgct
gtggagtatagcgactcggaagatgactcggagttcgatgaagtagactggctggagtaa

DBGET integrated database retrieval system