KEGG   Mus musculus (mouse): 83768Help
Entry
83768             CDS       T01002                                 

Gene name
Dpp7, DPPII, Dpp2, QPP
Definition
(RefSeq) dipeptidylpeptidase 7
  KO
K01276  dipeptidyl-peptidase II [EC:3.4.14.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    83768 (Dpp7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.2  dipeptidyl-peptidase II
     83768 (Dpp7)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S28
   83768 (Dpp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S28 Abhydrolase_1 Hydrolase_4 Peptidase_S37 Peptidase_S9 Abhydrolase_6 DUF2920 Esterase Methyltransf_23 Abhydrolase_2 Phasin_2
Motif
Other DBs
NCBI-GeneID: 83768
NCBI-ProteinID: NP_114031
MGI: 1933213
Ensembl: ENSMUSG00000026958
Vega: OTTMUSG00000011997
UniProt: Q9ET22
Position
2; 2 A3
AA seq 506 aa AA seqDB search
MNFHPCYPVDHGVPSWILVLLLSLGLCNLQARADRVLDPDFHENYFEQYMDHFNFESFGN
KTFGQRFLVSDKFWKMGEGPIFFYTGNEGDIWSFANNSGFMVELAAQQEALLVFAEHRYY
GKSLPFGVQSTQRGYTQLLTVEQALADFAVLLQALRQDLGVHDAPTIAFGGSYGGMLSAY
MRMKYPHLVAGALAASAPVVAVAGLGDSYQFFRDVTADFYGQSPKCAQAVRDAFQQIKDL
FLQGAYDTISQNFGTCQSLSSPKDLTQLFGFARNAFTVLAMMDYPYPTDFLGPLPANPVK
VGCQRLLNEGQRIMGLRALAGLVYNSSGTEPCYDIYRLYQSCADPTGCGTGSDARAWDYQ
ACTEINLTFDSNNVTDMFPEIPFSEELRQQYCLDTWGVWPRQDWLQTSFWGGDLKAASNI
IFSNGDLDPWAGGGIQSNLSTSVIAVTIQGGAHHLDLRASNSEDPPSVVEVRKLESTLIR
EWVAAARLKQPAMPRWPGPKKQHPSR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccatccttgttaccctgtggaccatggtgtcccctcctggatcctggtcctg
ctgctgtcactgggactgtgcaacctccaggccagagccgacagagttctagaccctgac
tttcatgagaattattttgagcaatacatggaccatttcaactttgagagtttcggcaac
aaaacctttggccagcggttcctagtgtcagataagttctggaagatgggcgaagggccc
atctttttctacacagggaatgagggggatatctggtccttcgctaacaactctggcttc
atggtggaactggcagcccagcaggaggccctgcttgtctttgctgagcaccggtactat
gggaaatcgcttccgttcggtgtccagtccacacagcggggatatacacagctgctgact
gtggagcaggcgctggccgactttgctgtgctgctccaggccctgcggcaggaccttggg
gtccatgatgcccccaccatagcctttggagggagttatggggggatgctgagtgcctac
atgaggatgaagtacccccacctggtggctggggcactggcagccagcgctcctgttgta
gctgttgcaggccttggggactcctaccaattcttccgagatgtcacagcggacttttat
ggccagagtcccaagtgcgcccaggctgtgcgggatgcctttcagcaaatcaaagacttg
ttcctccagggagcctatgacaccatcagccagaactttggtacctgtcaatcactttcc
agcccaaaggacctgactcagctctttgggtttgcccgaaatgcatttactgtgctcgcc
atgatggactacccgtatcctactgactttctagggccccttcctgccaaccctgtcaag
gtgggctgtcaacggctgttgaatgagggccagaggatcatgggtctacgggcactggca
gggctggtctacaactcctctggcacggaaccctgttatgacatctaccggttataccaa
agctgtgctgaccccactggctgtggcactggctctgacgctagggcttgggactaccag
gcctgtacggagatcaatctgacctttgacagcaacaatgtgacagacatgtttcctgaa
atcccattctctgaagaactccgccagcaatactgtctggatacatggggcgtgtggcct
cggcaagactggctgcagaccagcttctggggtggtgaccttaaagcagccagcaacatc
attttctccaacggtgacctagacccctgggcagggggcgggatccagagcaacctgagt
acatcagtcattgctgtcaccatccaggggggagcacatcacctagatctcagagcatct
aactcagaagaccccccatctgtcgtggaggtgcgtaagctggaatctaccctcattcgt
gagtgggtagcagcagccagactaaagcaaccagcaatgccacggtggcctgggcctaag
aagcagcacccttccagataa

DBGET integrated database retrieval system